Преглед изворни кода

Merge pull request #2 from LegumeFederation/7.x-1.x

Merging LegumeFederation Tripal Blast modifications
Lacey-Anne Sanderson пре 10 година
родитељ
комит
74784e7bb6

+ 52 - 10
api/blast_ui.api.inc

@@ -107,12 +107,12 @@ function get_blast_database_options($type) {
  *   BLAST job (ie: 250)
  *   BLAST job (ie: 250)
  */
  */
 function run_BLAST_tripal_job($program, $query, $database, $output_filestub, $options, $job_id = NULL) {
 function run_BLAST_tripal_job($program, $query, $database, $output_filestub, $options, $job_id = NULL) {
-
- $output_file = file_directory_temp() .  DIRECTORY_SEPARATOR . $output_filestub . '.blast.asn';
- $output_file_xml = variable_get('file_public_path', conf_path() . '/files') . DIRECTORY_SEPARATOR . $output_filestub . '.blast.xml';
- $output_file_tsv = variable_get('file_public_path', conf_path() . '/files') . DIRECTORY_SEPARATOR . $output_filestub . '.blast.tsv';
- $output_file_html = variable_get('file_public_path', conf_path() . '/files') . DIRECTORY_SEPARATOR . $output_filestub . '.blast.html';
-
+  $output_file = file_directory_temp() .  DIRECTORY_SEPARATOR . $output_filestub . '.blast.asn';
+  $output_dir = variable_get('file_public_path', conf_path() . '/files') 
+              . DIRECTORY_SEPARATOR . 'tripal' . DIRECTORY_SEPARATOR . 'tripal_blast';
+  $output_file_xml = $output_dir . DIRECTORY_SEPARATOR . $output_filestub . '.blast.xml';
+  $output_file_tsv = $output_dir . DIRECTORY_SEPARATOR . $output_filestub . '.blast.tsv';
+  $output_file_html = $output_dir . DIRECTORY_SEPARATOR . $output_filestub . '.blast.html';
 
 
   print "\nExecuting $program\n\n";
   print "\nExecuting $program\n\n";
   print "Query: $query\n";
   print "Query: $query\n";
@@ -123,11 +123,15 @@ function run_BLAST_tripal_job($program, $query, $database, $output_filestub, $op
 
 
   // Allow administrators to use an absolute path for these commands.
   // Allow administrators to use an absolute path for these commands.
   // Defaults to using $PATH.
   // Defaults to using $PATH.
-	$blast_path = variable_get('blast_path', '');
+	$blast_path    = variable_get('blast_path', '');
 	$blast_threads = variable_get('blast_threads', '');
 	$blast_threads = variable_get('blast_threads', '');
 	
 	
-	$program = 	$blast_path . $program;
-	$blast_formatter_command = $blast_path .  'blast_formatter';
+	// Strip the extension off the BLAST target
+	$database = preg_replace("/(.*)\.[pn]\w\w/", '$1', $database);
+	
+	// The executables:
+	$program       = $blast_path . $program;
+	$blast_formatter_command = $blast_path . 'blast_formatter';
 
 
   $blast_cmd = "$program -query '$query' -db '$database' -out '$output_file' -outfmt=11";
   $blast_cmd = "$program -query '$query' -db '$database' -out '$output_file' -outfmt=11";
   if (!empty($options)) {
   if (!empty($options)) {
@@ -155,7 +159,9 @@ function run_BLAST_tripal_job($program, $query, $database, $output_filestub, $op
   print "\nGenerating additional download formats...\n";
   print "\nGenerating additional download formats...\n";
 
 
   print "\tXML\n";
   print "\tXML\n";
-  system("$blast_formatter_command -archive $output_file -outfmt 5 -out $output_file_xml");
+  $format_cmd = "$blast_formatter_command -archive $output_file -outfmt 5 -out $output_file_xml";
+  print "\nExecuting $format_cmd\n\n";
+  system($format_cmd);
   if(!file_exists($output_file_xml)) {
   if(!file_exists($output_file_xml)) {
     tripal_report_error(
     tripal_report_error(
       'blast_ui',
       'blast_ui',
@@ -274,3 +280,39 @@ function get_blastdb_linkout_regex($node, $options = array()) {
 
 
   return $regex;
   return $regex;
 }
 }
+
+
+function get_recent_jobs() {
+  $html = '';
+  
+  $sid = session_id();  
+  $jobs = $_SESSION['all_jobs'][$sid];
+
+  // Remove jobs older than 48 hours
+  foreach ($jobs as $job_id => $job) {
+    if ($diff = abs(time() - strtotime($job['date'])) > 172800) {
+      unset($jobs[$job_id]);
+    }
+  }
+  $_SESSION['all_jobs'][$sid] = $jobs;
+  
+  if (count($jobs) > 0) {
+    $html = "
+    <h3><strong> Recent Jobs </h3>
+    <dl>";
+
+    foreach (array_reverse($jobs) as $job) {
+      $q_def = !isset($job['query_defs'][0]) ? "Query" : $job['query_defs'][0];
+      $html .= "
+        <dd>
+          <a href='" . "../../" . $job['job_output_url'] ."'>
+            $q_def X " . $job['target'] . ' (' . $job['program'] . ') - ' . $job['date'] . "
+          </a>
+        </dd>";
+    }
+     $html .= "
+    </dl>";
+  }
+  
+  return $html;
+}

+ 2 - 1
blast_ui.install

@@ -69,9 +69,11 @@ function blast_ui_schema(){
         'default' => 'link'
         'default' => 'link'
       ),
       ),
     ),
     ),
+    
     'indexes' => array(
     'indexes' => array(
       'name' => array('name'),
       'name' => array('name'),
     ),
     ),
+    
     'primary key' => array('nid'),
     'primary key' => array('nid'),
     'unique keys' => array(
     'unique keys' => array(
        'nid' => array('nid'),
        'nid' => array('nid'),
@@ -79,7 +81,6 @@ function blast_ui_schema(){
   );
   );
 
 
   return $schema;
   return $schema;
-
 }
 }
 
 
 /**
 /**

+ 26 - 41
blast_ui.module

@@ -9,13 +9,14 @@
 require_once 'includes/blast_ui.form_common.inc';
 require_once 'includes/blast_ui.form_common.inc';
 require_once 'includes/blast_ui.form_advanced_options.inc';
 require_once 'includes/blast_ui.form_advanced_options.inc';
 // NOTE: The forms themeselves are included using hook_menu to ensure they
 // NOTE: The forms themeselves are included using hook_menu to ensure they
-// are only inlcuded when needed.
+// are only included when needed.
 
 
 // BLAST DB Node functionality
 // BLAST DB Node functionality
 require_once 'includes/blast_ui.node.inc';
 require_once 'includes/blast_ui.node.inc';
 
 
 // BLAST Link-out functionality.
 // BLAST Link-out functionality.
 require_once 'includes/blast_ui.linkouts.inc';
 require_once 'includes/blast_ui.linkouts.inc';
+include_once('includes/blast_ui.custom.inc');
 
 
 // Functions specific to themeing (ie: preprocess)
 // Functions specific to themeing (ie: preprocess)
 require_once 'theme/blast_ui.theme.inc';
 require_once 'theme/blast_ui.theme.inc';
@@ -219,7 +220,7 @@ function show_blast_output($job_id) {
   // BLAST is in the queue, running or complete in order to determine what to show the user
   // BLAST is in the queue, running or complete in order to determine what to show the user
   //decode the job_id
   //decode the job_id
   $job_id = base64_decode($job_id);
   $job_id = base64_decode($job_id);
-	$job = tripal_get_job($job_id);
+  $job = tripal_get_job($job_id);
 
 
   // 1) Job is in the Queue
   // 1) Job is in the Queue
   if ($job->start_time === NULL AND $job->end_time == NULL) {
   if ($job->start_time === NULL AND $job->end_time == NULL) {
@@ -252,50 +253,15 @@ function show_blast_output($job_id) {
  *
  *
  */
  */
 function ajax_blast_ui_example_sequence_callback($form, $form_state) {
 function ajax_blast_ui_example_sequence_callback($form, $form_state) {
-
-  // First, set a default example sequence in case administrators have not yet
-  // bothered to set their own.
   $sequence_type = $form_state['values']['query_type'];
   $sequence_type = $form_state['values']['query_type'];
   if ($sequence_type == 'nucleotide') {
   if ($sequence_type == 'nucleotide') {
-    $default_example_sequence = '>partial lipoxygenase Glyma15g03040
-TTTCGTATGA GATTAAAATG TGTGAAATTT TGTTTGATAG GACATGGGAA
-AGGAAAAGTT GGAAAGGCTA CAAATTTAAG AGGACAAGTG TCGTTACCAA
-CCTTGGGAGC TGGCGAAGAT GCATACGATG TTCATTTTGA ATGGGACAGT
-GACTTCGGAA TTCCCGGTGC ATTTTACATT AAGAACTTCA TGCAAGTTGA
-GTTCTATCTC AAGTCTCTAA CTCTCGAAGA CATTCCAAAC CACGGAACCA
-TTCACTTCGT ATGCAACTCC TGGGTTTACA ACTCAAAATC CTACCATTCT
-GATCGCATTT TCTTTGCCAA CAATGTAAGC TACTTAAATA CTGTTATACA
-TTGTCTAACA TCTTGTTAGA GTCTTGCATG ATGTGTACCG TTTATTGTTG
-TTGTTGAACT TTACCACATG GCATGGATGC AAAAGTTGTT ATACACATAA
-ATTATAATGC AGACATATCT TCCAAGCGAG ACACCGGCTC CACTTGTCAA
-GTACAGAGAA GAAGAATTGA AGAATGTAAG AGGGGATGGA ACTGGTGAGC
-GCAAGGAATG GGATAGGATC TATGATTATG ATGTCTACAA TGACTTGGGC
-GATCCAGATA AGGGTGAAAA GTATGCACGC CCCGTTCTTG GAGGTTCTGC
-CTTACCTTAC CCTCGCAGAG GAAGAACCGG AAGAGGAAAA ACTAGAAAAG
-GTTTCTCACT AGTCACTAAT TTATTACTTT TTAATGTTTG TTTTTAGGCA
-TCTTTTCTGA TGAAATGTAT ACTTTTGATG TTTTTTTGTT TTAGCATAAC
-TGAATTAGTA AAGTGTGTTG TGTTCCTTAG AAGTTAGAAA AGTACTAAGT
-ATAAGGTCTT TGAGTTGTCG TCTTTATCTT AACAGATCCC AACAGTGAGA
-AGCCCAGTGA TTTTGTTTAC CTTCCGAGAG ATGAAGCATT TGGTCACTTG
-AAGTCATCAG ATTTTCTCGT TTATGGAATC AAATCAGTGG CTCAAGACGT
-CTTGCCCGTG TTGACTGATG CGTTTGATGG CAATCTTTTG AGCCTTGAGT
-TTGATAACTT TGCTGAAGTG CGCAAACTCT ATGAAGGTGG AGTTACACTA
-CCTACAAACT TTCTTAGCAA GATCGCCCCT ATACCAGTGG TCAAGGAAAT
-TTTTCGAACT GATGGCGAAC AGTTCCTCAA GTATCCACCA CCTAAAGTGA
-TGCAGGGTAT GCTACATATT TTGAATATGT AGAATATTAT CAATATACTC
-CTGTTTTTAT TCAACATATT TAATCACATG GATGAATTTT TGAACTGTTA';
+    $default_example_sequence = variable_get('blast_ui_nucleotide_example_sequence', 'sample');
   }
   }
   elseif ($sequence_type == 'protein') {
   elseif ($sequence_type == 'protein') {
-    $default_example_sequence = '>gi|166477|gb|AAA96434.1| resveratrol synthase [Arachis hypogaea]
-MVSVSGIRKVQRAEGPATVLAIGTANPPNCIDQSTYADYYFRVTNSEHMTDLKKKFQRICERTQIKNRHM
-YLTEEILKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGV
-DYELIVLLGLDPCVKRYMMYHQGCFAGGTVLRLAKDLAENNKDARVLIVCSENTAVTFRGPSETDMDSLV
-GQALFADGAAAIIIGSDPVPEVEKPIFELVSTDQKLVPGSHGAIGGLLREVGLTFYLNKSVPDIISQNIN
-DALNKAFDPLGISDYNSIFWIAHPGGRAILDQVEQKVNLKPEKMKATRDVLSNYGNMSSACVFFIMDLMR
-KRSLEEGLKTTGEGLDWGVLFGFGPGLTIETVVLRSVAI';
+    $default_example_sequence = variable_get('blast_ui_protein_example_sequence', 'sample');
   }
   }
   else {
   else {
-    $default_example_sequence = '';
+    $default_example_sequence = 'unknown query type';
   }
   }
 
 
   // If the Show Example checkbox is true then put the example in the textfield
   // If the Show Example checkbox is true then put the example in the textfield
@@ -313,5 +279,24 @@ KRSLEEGLKTTGEGLDWGVLFGFGPGLTIETVVLRSVAI';
   }
   }
 
 
   return $form['query']['FASTA'];
   return $form['query']['FASTA'];
+}
+
 
 
-}
+/**
+ * Enable web services API
+ *
+ * @param $owner
+ *   
+ * @param $api
+ *
+ * @return $result
+ *  
+ */
+function blast_ui_ctools_plugin_api($owner, $api) {
+  if ($owner == 'services' && $api == 'services') {
+    return array(
+      'version' => 3,
+      'file' => 'includes/blast_ui.services.inc'
+    );
+  }
+}

+ 1 - 1
includes/blast_ui.admin.inc

@@ -136,7 +136,7 @@ function blast_ui_admin_form_validate($form, &$form_state) {
  *
  *
  */
  */
 function blast_ui_admin_form_submit($form, $form_state) {
 function blast_ui_admin_form_submit($form, $form_state) {
-
+  variable_set('blast_path', $form_state['values']['blast_path']);
   variable_set('blast_ui_allow_target_upload', $form_state['values']['target_upload']);
   variable_set('blast_ui_allow_target_upload', $form_state['values']['target_upload']);
 	variable_set('blast_threads', $form_state['values']['blast_threads']);
 	variable_set('blast_threads', $form_state['values']['blast_threads']);
   variable_set('blast_ui_nucleotide_example_sequence', $form_state['values']['nucleotide_example']);
   variable_set('blast_ui_nucleotide_example_sequence', $form_state['values']['nucleotide_example']);

+ 129 - 0
includes/blast_ui.custom.inc

@@ -0,0 +1,129 @@
+<?php
+/*
+ * customized for PeanutBase
+ *
+ */
+ 
+function tripal_custom_generate_linkout($url_prefix, $hit, $info, $options = array()) {
+// uncomment to see contents of hit object
+//echo "hit:<pre>";var_dump($hit);echo "</pre>";
+// uncomment to see contents of info object
+//echo "info:<pre>";var_dump($info);echo "</pre>";
+
+  $url = false;
+  $hit_name = $hit->{'Hit_def'};
+//echo "hit name: $hit_name ... ";
+
+  if ($info['Target'] == 'All genomes') {
+    // default regex
+    $regex = "/^\w+\.(\S+).*/";
+    
+    if (preg_match('/^aradu/', $hit_name) == 1) {
+      $blastdb_name = 'PeanutBase_aradu_gbrowse';
+    }
+    else if (preg_match('/^araip/', $hit_name) == 1) {
+      $blastdb_name = 'PeanutBase_araip_gbrowse';
+    }
+    else if (preg_match('/^cajca/', $hit_name) == 1) {
+      $blastdb_name = 'LegumeInfo_cajca_gbrowse';
+    }
+    else if (preg_match('/^cicar/', $hit_name) == 1) {
+      $blastdb_name = 'LegumeInfo_cicar_gbrowse';
+    }
+    else if (preg_match('/^glyma/', $hit_name) == 1) {
+      $blastdb_name = 'SoyBase_glyma_gbrowse';
+    }
+    else if (preg_match('/^lotja/', $hit_name) == 1) {
+      $blastdb_name = 'LegumeInfo_lotja_gbrowse';
+    }
+    else if (preg_match('/^medtr/', $hit_name) == 1) {
+      $blastdb_name = 'LegumeInfo_medtr_gbrowse';
+    }
+    else if (preg_match('/^phavu/', $hit_name) == 1) {
+      $blastdb_name = 'LegumeInfo_phavu_gbrowse';
+    }
+    else if (preg_match('/^vigra/', $hit_name) == 1) {
+      $blastdb_name = 'LegumeInfo_vigra_gbrowse';
+    }
+    else {
+      // Don't know what to do with this hit
+      drupal_set_message("Don't know how to create GBrowse linkout for $hit_name", 'error');
+    }  
+
+    $hit_name = preg_replace($regex, '$1', $hit_name);
+    $hit->{'linkout_id'} = $hit_name;
+    if ($blastdb_info = tripal_custom_getBLASTdbinfo($blastdb_name)) {
+//echo "generate gbrowse link with " . $blastdb_info['urlprefix'] . " $hit<br>";
+      $url = tripal_blast_generate_linkout_gbrowse($blastdb_info['urlprefix'], $hit, $info, $options);
+    }
+  }//handle All genomes BLAST target
+  
+  else {
+    // default regex:
+    $regex = "/^\w+\.(\S+)/";
+    
+    if (preg_match('/^aradu/', $hit_name) == 1) {
+      $blastdb_name = 'PeanutBase_aradu_gene';
+    }
+    else if (preg_match('/^araip/', $hit_name) == 1) {
+      $blastdb_name = 'PeanutBase_araip_gene';
+    }
+    else if (preg_match('/^cajca/', $hit_name) == 1) {
+      $blastdb_name = 'LegumeInfo_cajca_gene';
+    }
+    else if (preg_match('/^cicar/', $hit_name) == 1) {
+      $blastdb_name = 'LegumeInfo_cicar_gene';
+    }
+    else if (preg_match('/^glyma/', $hit_name) == 1) {
+      $blastdb_name = 'LegumeInfo_glyma_gene';
+      if (preg_match("/^\w+\.(\S+)\.p/", $hit_name)) {
+        //glyma protein
+        $regex = "/^\w+\.(\S+)\.p/";
+      }
+    }
+    else if (preg_match('/^lotja/', $hit_name) == 1) {
+      $blastdb_name = 'LegumeInfo_lotja_gene';
+    }
+    else if (preg_match('/^medtr/', $hit_name) == 1) {
+      $blastdb_name = 'LegumeInfo_medtr_gene';
+    }
+    else if (preg_match('/^phavu/', $hit_name) == 1) {
+      $blastdb_name = 'LegumeInfo_phavu_gene';
+    }
+    else if (preg_match('/^vigra/', $hit_name) == 1) {
+      $blastdb_name = 'LegumeInfo_vigra_gene';
+    }
+    else {
+      // Don't know what to do with this hit
+      drupal_set_message("Don't know how to create linkout for $hit_name", 'error');
+    }  
+
+    $hit_name = preg_match($regex, $hit_name, $matches);
+//echo "<br>Using $regex, found matches:<pre>" . var_dump($matches);echo "</pre>";
+//echo "<br>Use [" . $matches[1] . "]<br>";
+    $hit->{'linkout_id'} = $matches[1];
+//echo "look for gene link for $blastdb_name with " . $hit->{'linkout_id'} . "<br>";
+    if ($blastdb_info = tripal_custom_getBLASTdbinfo($blastdb_name)) {
+//echo "generate gbrowse link with " . $blastdb_info['urlprefix'] . " $hit<br>";
+      $url = tripal_blast_generate_linkout_link($blastdb_info['urlprefix'], $hit, $info, $options);
+    }
+  }
+  return $url;
+}
+
+
+function tripal_custom_getBLASTdbinfo($blastdb_name) {
+  $sql = "
+    SELECT urlprefix 
+    FROM {db} WHERE name='$blastdb_name'";
+//echo "$sql<br>";
+  if ($res = chado_query($sql)) {
+    if ($row=$res->fetchObject()) {
+      return array(
+        'urlprefix' => $row->urlprefix, 
+      );
+    }
+  }
+  
+  return false;
+}//tripal_custom_getBLASTdbinfo

+ 493 - 242
includes/blast_ui.form_advanced_options.inc

@@ -23,6 +23,16 @@
  *   The current state fo the form passed in as $form.
  *   The current state fo the form passed in as $form.
  */
  */
 function blast_ui_blastn_advanced_options_form(&$form, $form_state) {
 function blast_ui_blastn_advanced_options_form(&$form, $form_state) {
+  $all_job_data = variable_get('job_data', '');
+  if (isset($_GET['jid']) && isset($all_job_data)) {    
+     $jid = base64_decode($_GET['jid']);
+     $job_data = $all_job_data[$jid];
+  }
+  else {
+    $job_data = array();
+    $jid = 0;
+  }
+  $defaults = _get_default_values($job_data, 'blastn');
 
 
   // General parameters
   // General parameters
   //.........................
   //.........................
@@ -36,58 +46,40 @@ function blast_ui_blastn_advanced_options_form(&$form, $form_state) {
   $form['ALG']['GParam']['maxTarget'] = array(
   $form['ALG']['GParam']['maxTarget'] = array(
     '#type' => 'select',
     '#type' => 'select',
     '#title' => t('Max target sequences:'),
     '#title' => t('Max target sequences:'),
-    '#options' => array(
-      0 => t('10'),
-      1 => t('50'),
-      2 => t('100'),
-      3 => t('250'),
-      4 => t('500'),
-      5 => t('1000'),
-      6 => t('5000'),
-      7 => t('10000'),
-      8 => t('20000'),
-    ),
-    '#default_value' => 2,
+    '#options' => _get_max_target('blastn'),
+    '#default_value' => $defaults['max_target_seqs'],
     '#description' => t('Select the maximum number of aligned sequences to display'),
     '#description' => t('Select the maximum number of aligned sequences to display'),
   );
   );
 
 
+/*eksc- remove until we learn how this is implemented by NCBI
   $form['ALG']['GParam']['shortQueries'] = array(
   $form['ALG']['GParam']['shortQueries'] = array(
     '#type' => 'checkbox',
     '#type' => 'checkbox',
     '#title' => t('Automatically adjust parameters for short input sequences'),
     '#title' => t('Automatically adjust parameters for short input sequences'),
-    '#default_value' => TRUE,
+    '#default_value' => $short_queries,
   );
   );
+*/
 
 
   $form['ALG']['GParam']['eVal'] = array(
   $form['ALG']['GParam']['eVal'] = array(
     '#type' => 'textfield',
     '#type' => 'textfield',
     '#title' => t('e-Value (Expected Threshold)'),
     '#title' => t('e-Value (Expected Threshold)'),
-    '#default_value' => 10,
+    '#default_value' => $defaults['evalue'],
     '#size' => 12,
     '#size' => 12,
     '#maxlength' => 20,
     '#maxlength' => 20,
-    '#description' => t('Expected number of chance matches in a random model. This number should be give in a decimal format. <a href="http://www.ncbi.nlm.nih.gov/BLAST/blastcgihelp.shtml#expect" target="_blank">More Information</a> | <a href="https://www.youtube.com/watch?v=nO0wJgZRZJs" target="_blank">Expect value vedio tutorial</a>'),
+    '#description' => t('Expected number of chance matches in a random model. This number should be give in a decimal format. <a href="http://www.ncbi.nlm.nih.gov/BLAST/blastcgihelp.shtml#expect" target="_blank">More Information</a> | <a href="https://www.youtube.com/watch?v=nO0wJgZRZJs" target="_blank">Expect value video tutorial</a>'),
   );
   );
 
 
   $form['ALG']['GParam']['wordSize'] = array(
   $form['ALG']['GParam']['wordSize'] = array(
     '#type' => 'select',
     '#type' => 'select',
     '#title' => t('Word size:'),
     '#title' => t('Word size:'),
-    '#options' => array(
-      0 => t('16'),
-      1 => t('20'),
-      2 => t('24'),
-      3 => t('28'),
-      4 => t('32'),
-      5 => t('48'),
-      6 => t('64'),
-      7 => t('128'),
-      8 => t('256'),
-    ),
-    '#default_value' => 3,
+    '#options' => _get_word_size('blastn'),
+    '#default_value' => $defaults['word_size'],
     '#description' => t('The length of the seed that initiates an alignment'),
     '#description' => t('The length of the seed that initiates an alignment'),
   );
   );
 
 
   $form['ALG']['GParam']['qRange'] = array(
   $form['ALG']['GParam']['qRange'] = array(
     '#type' => 'textfield',
     '#type' => 'textfield',
     '#title' => t('Max matches in a query range'),
     '#title' => t('Max matches in a query range'),
-    '#default_value' => 0,
+    '#default_value' => $defaults['qRange'],
     '#size' => 12,
     '#size' => 12,
     '#maxlength' => 20,
     '#maxlength' => 20,
     '#description' => t('Limit the number of matches to a query range. This option is useful if many strong matches to one part of a query may prevent BLAST from presenting weaker matches to another part of the query.'),
     '#description' => t('Limit the number of matches to a query range. This option is useful if many strong matches to one part of a query may prevent BLAST from presenting weaker matches to another part of the query.'),
@@ -105,34 +97,18 @@ function blast_ui_blastn_advanced_options_form(&$form, $form_state) {
   $form['ALG']['SParam']['M&MScores'] = array(
   $form['ALG']['SParam']['M&MScores'] = array(
     '#type' => 'select',
     '#type' => 'select',
     '#title' => t('Match/Mismatch Scores:'),
     '#title' => t('Match/Mismatch Scores:'),
-    '#options' => array(
-       0 => t('1,-2'),
-       1 => t('1,-3'),
-       2 => t('1,-4'),
-       3 => t('2,-3'),
-       4 => t('4,-5'),
-       5 => t('1,-1'),
-     ),
-    '#default_value' => 0,
+    '#options' => _get_match_mismatch('blastn'),
+    '#default_value' => $defaults['matchmiss'],
     '#description' => t('Reward and penalty for matching and mismatching bases.'),
     '#description' => t('Reward and penalty for matching and mismatching bases.'),
    );
    );
 
 
    $form['ALG']['SParam']['gapCost'] = array(
    $form['ALG']['SParam']['gapCost'] = array(
     '#type' => 'select',
     '#type' => 'select',
     '#title' => t('Gap Costs:'),
     '#title' => t('Gap Costs:'),
-    '#options' => array(
-      0 => t('Existence: 5 Extension: 2'),
-      1 => t('Existence: 2 Extension: 2'),
-      2 => t('Existence: 1 Extension: 2'),
-      3 => t('Existence: 0 Extension: 2'),
-      4 => t('Existence: 3 Extension: 1'),
-      5 => t('Existence: 2 Extension: 1'),
-      6 => t('Existence: 1 Extension: 1'),
-    ),
-    '#default_value' => 0,
+    '#options' => _get_gap('blastn'),
+    '#default_value' => $defaults['gap'],
     '#description' => t('Cost to create and extend a gap in an alignment. Linear costs are available only with megablast and are determined by the match/mismatch scores.'),
     '#description' => t('Cost to create and extend a gap in an alignment. Linear costs are available only with megablast and are determined by the match/mismatch scores.'),
   );
   );
-
 }
 }
 
 
 /**
 /**
@@ -148,7 +124,6 @@ function blast_ui_blastn_advanced_options_form_validate($form, $form_state) { }
  * @see blast_ui_blastn_advanced_options_form().
  * @see blast_ui_blastn_advanced_options_form().
  */
  */
 function blast_ui_blastn_advanced_options_form_submit($form, $form_state) {
 function blast_ui_blastn_advanced_options_form_submit($form, $form_state) {
-
   $eVal = $form_state['values']['eVal'];
   $eVal = $form_state['values']['eVal'];
 
 
   $trgtKey = $form_state['values']['maxTarget'];
   $trgtKey = $form_state['values']['maxTarget'];
@@ -158,77 +133,25 @@ function blast_ui_blastn_advanced_options_form_submit($form, $form_state) {
   $wordSize = $form['ALG']['GParam']['wordSize']['#options'][$wsKey];
   $wordSize = $form['ALG']['GParam']['wordSize']['#options'][$wsKey];
 
 
   // Expand Gap Cost key into open and extend penalties
   // Expand Gap Cost key into open and extend penalties
-  $gapKey = $form_state['values']['gapCost'];
-  switch ($gapKey) {
-   case 0:
-      $gapOpen = 5;
-      $gapExtend = 2;
-      break;
-   case 1:
-      $gapOpen = 2;
-      $gapExtend = 2;
-      break;
-   case 2:
-      $gapOpen = 1;
-      $gapExtend = 2;
-      break;
-   case 3:
-      $gapOpen = 0;
-      $gapExtend = 2;
-      break;
-   case 4:
-      $gapOpen = 3;
-      $gapExtend = 1;
-      break;
-   case 5:
-      $gapOpen = 2;
-      $gapExtend = 1;
-      break;
-   case 6:
-      $gapOpen = 1;
-      $gapExtend = 1;
-      break;
-  }
+  $gap = _set_gap($form_state['values']['gapCost']);
 
 
-  // Epand Match/Mismatch option into penalty/reward values
-  // @todo Amir: Is the switch supposed to be for $scoreKey?
-  $scoreKey = $form_state['values']['M&MScores'];
-  switch ($gapKey) {
-   case 0:
-      $penalty = -2;
-      $reward = 1;
-      break;
-   case 1:
-      $penalty = -3;
-      $reward = 1;
-      break;
-   case 2:
-      $penalty = -4;
-      $reward = 1;
-      break;
-   case 3:
-      $penalty = -3;
-      $reward = 2;
-      break;
-   case 4:
-      $penalty = -5;
-      $reward = 4;
-      break;
-   case 5:
-      $penalty = -1;
-      $reward = 1;
-      break;
-  }
+  // Expand Match/Mismatch option into penalty/reward values
+  $m_m = _set_match_mismatch($form_state['values']['M&MScores']);
+
+  // Limit number of query hits
+  $qRange = $form_state['values']['qRange'];
 
 
   return array(
   return array(
-    'evalue' => $eVal,
-    'word_size' => $wordSize,
-    'gapopen' => $gapOpen,
-    'gapextend' => $gapExtend,
-    'penalty' =>  $penalty,
-    'reward' => $reward
+  	'max_target_seqs' => $numAlign,
+    'evalue'          => $eVal,
+    'word_size'       => $wordSize,
+    'gapopen'         => $gap['gapOpen'],
+    'gapextend'       => $gap['gapExtend'],
+    'penalty'         => $m_m['penalty'],
+    'reward'          => $m_m['reward'],
+    'culling_limit'   => $qRange,
   );
   );
-}
+}//blast_ui_blastn_advanced_options_form_submit
 
 
 /**
 /**
  * @section
  * @section
@@ -248,8 +171,18 @@ function blast_ui_blastn_advanced_options_form_submit($form, $form_state) {
  *   The current state fo the form passed in as $form.
  *   The current state fo the form passed in as $form.
  */
  */
 function blast_ui_blastx_advanced_options_form(&$form, $form_state) {
 function blast_ui_blastx_advanced_options_form(&$form, $form_state) {
+  $all_job_data = variable_get('job_data', '');
+  if (isset($_GET['jid']) && isset($all_job_data)) {    
+     $jid = base64_decode($_GET['jid']);
+     $job_data = $all_job_data[$jid];
+  }
+  else {
+    $job_data = array();
+    $jid = 0;
+  }
+  $defaults = _get_default_values($job_data, 'blastx');
 
 
-  $form['ALG']['GParam'] = array(
+   $form['ALG']['GParam'] = array(
    '#type' => 'fieldset',
    '#type' => 'fieldset',
    '#title' => t('General parameters'),
    '#title' => t('General parameters'),
    '#collapsible' => FALSE,
    '#collapsible' => FALSE,
@@ -258,30 +191,82 @@ function blast_ui_blastx_advanced_options_form(&$form, $form_state) {
   $form['ALG']['GParam']['maxTarget'] = array(
   $form['ALG']['GParam']['maxTarget'] = array(
     '#type' => 'select',
     '#type' => 'select',
     '#title' => t('Max target sequences:'),
     '#title' => t('Max target sequences:'),
-    '#options' => array(
-      0 => t('10'),
-      1 => t('50'),
-      2 => t('100'),
-      3 => t('250'),
-      4 => t('500'),
-      5 => t('1000'),
-      6 => t('5000'),
-      7 => t('10000'),
-      8 => t('20000'),
-    ),
-    '#default_value' => 2,
+    '#options' => _get_max_target('blastx'),
+    '#default_value' => $defaults['max_target_seqs'],
     '#description' => t('Select the maximum number of aligned sequences to display'),
     '#description' => t('Select the maximum number of aligned sequences to display'),
   );
   );
 
 
   $form['ALG']['GParam']['eVal'] = array(
   $form['ALG']['GParam']['eVal'] = array(
     '#type' => 'textfield',
     '#type' => 'textfield',
     '#title' => t('e-Value (Expected Threshold)'),
     '#title' => t('e-Value (Expected Threshold)'),
-    '#default_value' => 10,
+    '#default_value' => $defaults['evalue'],
     '#size' => 12,
     '#size' => 12,
     '#maxlength' => 20,
     '#maxlength' => 20,
     '#description' => t('Expected number of chance matches in a random model. This number should be give in a decimal format. <a href="http://www.ncbi.nlm.nih.gov/BLAST/blastcgihelp.shtml#expect" target="_blank">More Information</a> | <a href="https://www.youtube.com/watch?v=nO0wJgZRZJs" target="_blank">Expect value vedio tutorial</a>'),
     '#description' => t('Expected number of chance matches in a random model. This number should be give in a decimal format. <a href="http://www.ncbi.nlm.nih.gov/BLAST/blastcgihelp.shtml#expect" target="_blank">More Information</a> | <a href="https://www.youtube.com/watch?v=nO0wJgZRZJs" target="_blank">Expect value vedio tutorial</a>'),
   );
   );
 
 
+/*eksc- need to learn how this is implemented for blastx
+  $form['ALG']['GParam']['shortQueries'] = array(
+    '#type' => 'checkbox',
+    '#title' => t('Automatically adjust parameters for short input sequences'),
+    '#default_value' => TRUE,
+  );
+*/
+
+  $form['ALG']['GParam']['wordSize'] = array(
+    '#type' => 'select',
+    '#title' => t('Word size:'),
+    '#options' => _get_word_size('blastx'),
+    '#default_value' => $defaults['word_size'],
+    '#description' => t('The length of the seed that initiates an alignment'),
+  );
+
+  // Scoring parameters
+  //.........................
+
+  $form['ALG']['SParam'] = array(
+    '#type' => 'fieldset',
+    '#title' => t('Scoring parameters'),
+    '#collapsible' => FALSE,
+  );
+
+  $matrix_options = _get_matrix_options();
+  $form['ALG']['SParam']['Matrix'] = array(
+    '#type' => 'select',
+    '#title' => 'Matrix',
+    '#options' => $matrix_options,
+    '#default_value' => $default['matrix'],
+    '#description' => t('Assigns a score for aligning pairs of residues, and determines overall alignment score..'),
+    '#ajax' => array(
+      'callback' => 'ajax_dependent_dropdown_callback',
+      'wrapper' => 'dropdown-second-replace',
+    ),
+  );
+
+  $form['ALG']['GParam']['qRange'] = array(
+    '#type' => 'textfield',
+    '#title' => t('Max matches in a query range'),
+    '#default_value' => $defaults['qRange'],
+    '#size' => 12,
+    '#maxlength' => 20,
+    '#description' => t('Limit the number of matches to a query range. This option is useful if many strong matches to one part of a query may prevent BLAST from presenting weaker matches to another part of the query.'),
+  );
+
+/*eksc- NOT match/mismatch but instead computational adjustments; 
+        need to learn how there are implemented for blastx
+  $form['ALG']['SParam']['M&MScores'] = array(
+    '#type' => 'select',
+    '#title' => t('Match/Mismatch Scores:'),
+    '#options' => array(
+				0 => t('No adjustment'),
+				1 => t('Composition-based statistics'),
+				2 => t('Conditional compositional score matrix adjustment'),
+				3 => t('Universal composition score matrix adjustment '),
+			),
+    '#default_value' => 2,
+    '#description' => t('Matrix adjustment method to compensate for amino acid composition of sequences'),
+  );
+*/
 }
 }
 
 
 /**
 /**
@@ -298,14 +283,8 @@ function blast_ui_blastx_advanced_options_form_validate($form, $form_state) { }
  */
  */
 function blast_ui_blastx_advanced_options_form_submit($form, $form_state) {
 function blast_ui_blastx_advanced_options_form_submit($form, $form_state) {
 
 
-  $eVal = $form_state['values']['eVal'];
-
-  $trgtKey = $form_state['values']['maxTarget'];
-  $numAlign = $form['ALG']['GParam']['maxTarget']['#options'][$trgtKey];
-
-  return array(
-    'evalue' => $eVal,
-  );
+  // Same as blastp form submit
+  return blast_ui_blastp_advanced_options_form_submit($form, $form_state);
 
 
 }
 }
 
 
@@ -327,6 +306,16 @@ function blast_ui_blastx_advanced_options_form_submit($form, $form_state) {
  *   The current state fo the form passed in as $form.
  *   The current state fo the form passed in as $form.
  */
  */
 function blast_ui_blastp_advanced_options_form(&$form, $form_state) {
 function blast_ui_blastp_advanced_options_form(&$form, $form_state) {
+  $all_job_data = variable_get('job_data', '');
+  if (isset($_GET['jid']) && isset($all_job_data)) {    
+     $jid = base64_decode($_GET['jid']);
+     $job_data = $all_job_data[$jid];
+  }
+  else {
+    $job_data = array();
+    $jid = 0;
+  }
+  $defaults = _get_default_values($job_data, 'blastp');
 
 
   //General parameters
   //General parameters
 
 
@@ -339,54 +328,43 @@ function blast_ui_blastp_advanced_options_form(&$form, $form_state) {
   $form['ALG']['GParam']['maxTarget'] = array(
   $form['ALG']['GParam']['maxTarget'] = array(
     '#type' => 'select',
     '#type' => 'select',
     '#title' => t('Max target sequences:'),
     '#title' => t('Max target sequences:'),
-    '#options' => array(
-       0 => t('10'),
-       1 => t('50'),
-       2 => t('100'),
-       3 => t('250'),
-       4 => t('500'),
-       5 => t('1000'),
-       6 => t('5000'),
-       7 => t('10000'),
-       8 => t('20000'),
-    ),
-    '#default_value' => 2,
+    '#options' => _get_max_target('blastp'),
+    '#default_value' => $defaults['max_target_seqs'],
     '#description' => t('Select the maximum number of aligned sequences to display'),
     '#description' => t('Select the maximum number of aligned sequences to display'),
   );
   );
 
 
+/*eksc- remove until we learn how this is implemented
   $form['ALG']['GParam']['shortQueries'] = array(
   $form['ALG']['GParam']['shortQueries'] = array(
    '#type' => 'checkbox',
    '#type' => 'checkbox',
    '#title' => t('Automatically adjust parameters for short input sequences'),
    '#title' => t('Automatically adjust parameters for short input sequences'),
    '#default_value' => TRUE,
    '#default_value' => TRUE,
   );
   );
+*/
 
 
   $form['ALG']['GParam']['eVal'] = array(
   $form['ALG']['GParam']['eVal'] = array(
-  	'#type' => 'textfield',
-  	'#title' => t('e-value(Expect threshold)'),
-  	'#default_value' => 10,
-  	'#size' => 12,
-  	'#maxlength' => 20,
-  	'#description' => t('Expected number of chance matches in a random model.'),
+    '#type' => 'textfield',
+    '#title' => t('e-value(Expect threshold)'),
+    '#default_value' => $defaults['evalue'],
+    '#size' => 12,
+    '#maxlength' => 20,
+    '#description' => t('Expected number of chance matches in a random model.'),
   );
   );
 
 
   $form['ALG']['GParam']['wordSize'] = array(
   $form['ALG']['GParam']['wordSize'] = array(
     '#type' => 'select',
     '#type' => 'select',
     '#title' => t('Word size:'),
     '#title' => t('Word size:'),
-    '#options' => array(
-       0 => t('2'),
-       1 => t('3'),
-    ),
-    '#default_value' => 1,
+    '#options' => _get_word_size('blastp'),
+    '#default_value' => $defaults['word_size'],
     '#description' => t('The length of the seed that initiates an alignment'),
     '#description' => t('The length of the seed that initiates an alignment'),
   );
   );
 
 
   $form['ALG']['GParam']['qRange'] = array(
   $form['ALG']['GParam']['qRange'] = array(
-   '#type' => 'textfield',
-   '#title' => t('Max matches in a query range'),
-   '#default_value' => 0,
-   '#size' => 12,
-   '#maxlength' => 20,
-   '#description' => t('Limit the number of matches to a query range. This option is useful if many strong matches to one part of a query may prevent BLAST from presenting weaker matches to another part of the query.'),
+    '#type' => 'textfield',
+    '#title' => t('Max matches in a query range'),
+    '#default_value' => $defaults['qRange'],
+    '#size' => 12,
+    '#maxlength' => 20,
+    '#description' => t('Limit the number of matches to a query range. This option is useful if many strong matches to one part of a query may prevent BLAST from presenting weaker matches to another part of the query.'),
   );
   );
 
 
   // Scoring parameters
   // Scoring parameters
@@ -397,31 +375,33 @@ function blast_ui_blastp_advanced_options_form(&$form, $form_state) {
    '#collapsible' => FALSE,
    '#collapsible' => FALSE,
   );
   );
 
 
-  $options_first = _ajax_example_get_first_dropdown_options();
-  $selected = isset($form_state['values']['MATRIX'] ) ? $form_state['values']['MATRIX'] : key($options_first);
-
-  $form['ALG']['SParam']['MATRIX'] = array(
+  $matrix_options = _get_matrix_options();
+  $form['ALG']['SParam']['Matrix'] = array(
     '#type' => 'select',
     '#type' => 'select',
     '#title' => 'Matrix',
     '#title' => 'Matrix',
-    '#options' => $options_first,
-    '#default_value' => $selected,
+    '#options' => $matrix_options,
+    '#default_value' => $defaults['matrix'],
     '#description' => t('Assigns a score for aligning pairs of residues, and determines overall alignment score..'),
     '#description' => t('Assigns a score for aligning pairs of residues, and determines overall alignment score..'),
     '#ajax' => array(
     '#ajax' => array(
-      'callback' => 'ajax_example_dependent_dropdown_callback',
+      'callback' => 'ajax_dependent_dropdown_callback',
       'wrapper' => 'dropdown-second-replace',
       'wrapper' => 'dropdown-second-replace',
     ),
     ),
   );
   );
 
 
+/*eksc- probably not used for blastp
   $form['ALG']['SParam']['gapCost'] = array(
   $form['ALG']['SParam']['gapCost'] = array(
     '#type' => 'select',
     '#type' => 'select',
     '#title' => t('Gap Costs:'),
     '#title' => t('Gap Costs:'),
     '#prefix' => '<div id="dropdown-second-replace">',
     '#prefix' => '<div id="dropdown-second-replace">',
     '#suffix' => '</div>',
     '#suffix' => '</div>',
-    '#options' => _ajax_example_get_second_dropdown_options($selected),
+    '#options' => _get_gap_for_matrix($selected),
     '#default_value' => 2,
     '#default_value' => 2,
     '#description' => t('Cost to create and extend a gap in an alignment.'),
     '#description' => t('Cost to create and extend a gap in an alignment.'),
   );
   );
+*/
 
 
+/*eksc- NOT match/mismatch but instead computational adjustments; 
+        need to learn how there are implemented for blastp
   $form['ALG']['SParam']['M&MScores'] = array(
   $form['ALG']['SParam']['M&MScores'] = array(
     '#type' => 'select',
     '#type' => 'select',
     '#title' => t('Match/Mismatch Scores:'),
     '#title' => t('Match/Mismatch Scores:'),
@@ -434,11 +414,11 @@ function blast_ui_blastp_advanced_options_form(&$form, $form_state) {
     '#default_value' => 2,
     '#default_value' => 2,
     '#description' => t('Matrix adjustment method to compensate for amino acid composition of sequences'),
     '#description' => t('Matrix adjustment method to compensate for amino acid composition of sequences'),
   );
   );
-
-}
+*/
+}//blast_ui_blastp_advanced_options_form
 
 
 /**
 /**
- * Validate the advanced options provided by the BLASTn form above.
+ * Validate the advanced options provided by the BLASTp form above.
  *
  *
  * @see blast_ui_blastp_advanced_options_form().
  * @see blast_ui_blastp_advanced_options_form().
  */
  */
@@ -459,11 +439,12 @@ function blast_ui_blastp_advanced_options_form_submit($form, $form_state) {
   $wsKey = $form_state['values']['wordSize'];
   $wsKey = $form_state['values']['wordSize'];
   $wordSize = $form['ALG']['GParam']['wordSize']['#options'][$wsKey];
   $wordSize = $form['ALG']['GParam']['wordSize']['#options'][$wsKey];
 
 
+  $qRange = $form_state['values']['qRange'];
+  
   // Expand Gap Cost key into open and extend penalties
   // Expand Gap Cost key into open and extend penalties
-  $gapKey = $form_state['values']['MATRIX'];
-  switch ($gapKey) {
-   case 0:
-     $matrix ="PAM30";
+  $matrix = $form_state['values']['Matrix'];
+  switch ($matrix) {
+   case 'PAM30':
      $gapKey = $form_state['values']['gapCost'];
      $gapKey = $form_state['values']['gapCost'];
      switch ($gapKey) {
      switch ($gapKey) {
       case 0:
       case 0:
@@ -492,8 +473,7 @@ function blast_ui_blastp_advanced_options_form_submit($form, $form_state) {
          break;
          break;
      }
      }
      break;
      break;
-   case 1:
-     $matrix ="PAM70";
+   case 'PAM70':
      $gapKey = $form_state['values']['gapCost'];
      $gapKey = $form_state['values']['gapCost'];
      switch ($gapKey) {
      switch ($gapKey) {
       case 0:
       case 0:
@@ -522,8 +502,7 @@ function blast_ui_blastp_advanced_options_form_submit($form, $form_state) {
          break;
          break;
      }
      }
      break;
      break;
-   case 2:
-     $matrix ="PAM250";
+   case 'PAM250':
      $gapKey = $form_state['values']['gapCost'];
      $gapKey = $form_state['values']['gapCost'];
      switch ($gapKey) {
      switch ($gapKey) {
       case 0:
       case 0:
@@ -588,8 +567,7 @@ function blast_ui_blastp_advanced_options_form_submit($form, $form_state) {
          break;
          break;
      }
      }
      break;
      break;
-   case 3:
-     $matrix ="BLOSUM80";
+   case 'BLOSUM80':
      $gapKey = $form_state['values']['gapCost'];
      $gapKey = $form_state['values']['gapCost'];
      switch ($gapKey) {
      switch ($gapKey) {
       case 0:
       case 0:
@@ -618,8 +596,7 @@ function blast_ui_blastp_advanced_options_form_submit($form, $form_state) {
          break;
          break;
      }
      }
       break;
       break;
-   case 4:
-     $matrix ="BLOSUM62";
+   case 'BLOSUM62':
      $gapKey = $form_state['values']['gapCost'];
      $gapKey = $form_state['values']['gapCost'];
      switch ($gapKey) {
      switch ($gapKey) {
       case 0:
       case 0:
@@ -668,8 +645,7 @@ function blast_ui_blastp_advanced_options_form_submit($form, $form_state) {
          break;
          break;
      }
      }
       break;
       break;
-   case 5:
-     $matrix ="BLOSUM45";
+   case 'BLOSUM45':
      $gapKey = $form_state['values']['gapCost'];
      $gapKey = $form_state['values']['gapCost'];
      switch ($gapKey) {
      switch ($gapKey) {
       case 0:
       case 0:
@@ -722,8 +698,7 @@ function blast_ui_blastp_advanced_options_form_submit($form, $form_state) {
          break;
          break;
      }
      }
      break;
      break;
-   case 6:
-     $matrix ="BLOSUM50";
+   case 'BLOSUM50':
      $gapKey = $form_state['values']['gapCost'];
      $gapKey = $form_state['values']['gapCost'];
      switch ($gapKey) {
      switch ($gapKey) {
       case 0:
       case 0:
@@ -788,8 +763,7 @@ function blast_ui_blastp_advanced_options_form_submit($form, $form_state) {
          break;
          break;
      }
      }
      break;
      break;
-   case 7:
-     $matrix ="BLOSUM90";
+   case 'BLOSUM90':
      $gapKey = $form_state['values']['gapCost'];
      $gapKey = $form_state['values']['gapCost'];
      switch ($gapKey) {
      switch ($gapKey) {
       case 0:
       case 0:
@@ -823,42 +797,47 @@ function blast_ui_blastp_advanced_options_form_submit($form, $form_state) {
      }
      }
      break;
      break;
   }
   }
+  
+//eksc- need to implement query range limit
+//  q_range
 
 
   return array(
   return array(
-    'evalue' => $eVal,
-    'word_size' => $wordSize,
-    'gapopen' => $gapOpen,
-    'gapextend' => $gapExtend,
-    'matrix' => $matrix
+  	'max_target_seqs' => $numAlign,
+    'evalue'          => $eVal,
+    'word_size'       => $wordSize,
+    'gapopen'         => $gapOpen,
+    'gapextend'       => $gapExtend,
+    'culling_limit'   => $qRange,
+    'matrix'          => $matrix,
   );
   );
-}
+}//blast_ui_blastp_advanced_options_form_submit
 
 
 /**
 /**
- * Fill the first dropdown list with appropriate options
+ * Fill the matrix dropdown list with appropriate options
  *
  *
  * @return
  * @return
  * An array consisting of matrices name for the first dropdown list
  * An array consisting of matrices name for the first dropdown list
  */
  */
-function _ajax_example_get_first_dropdown_options() {
+function _get_matrix_options() {
   return drupal_map_assoc(array(
   return drupal_map_assoc(array(
-  t('PAM30'),
-  t('PAM70'),
-  t('PAM250'),
-  t('BLOSUM80'),
-  t('BLOSUM62'),
-  t('BLOSUM45'),
-  t('BLOSUM50'),
-  t('BLOSUM90'),
+		t('PAM30'),
+		t('PAM70'),
+		t('PAM250'),
+		t('BLOSUM80'),
+		t('BLOSUM62'),
+		t('BLOSUM45'),
+		t('BLOSUM50'),
+		t('BLOSUM90'),
   ));
   ));
 }
 }
 
 
 /**
 /**
- * Fill the second dropdown list with appropriate options
+ * Fill the gap penalty dropdown list with appropriate options given selected matrix
  *
  *
  * @return
  * @return
  * An array containing open and extension gap values for the chosen matrix (to fill the second dropdown list)
  * An array containing open and extension gap values for the chosen matrix (to fill the second dropdown list)
  */
  */
-function _ajax_example_get_second_dropdown_options($key = '') {
+function _get_gap_for_matrix($key = '') {
   $options = array(
   $options = array(
     t('PAM30') => drupal_map_assoc(array(
     t('PAM30') => drupal_map_assoc(array(
       t('Existence: 7 Extension: 2'),
       t('Existence: 7 Extension: 2'),
@@ -954,18 +933,20 @@ function _ajax_example_get_second_dropdown_options($key = '') {
       t('Existence: 10 Extension: 1'),
       t('Existence: 10 Extension: 1'),
       t('Existence: 9 Extension: 1'),
       t('Existence: 9 Extension: 1'),
     )),
     )),
-    );
-    if (isset($options[$key])) {
-    	return $options[$key];
-    } else {
-    	return array();
-    }
-}
+  );
+  
+	if (isset($options[$key])) {
+		return $options[$key];
+	} 
+	else {
+		return array();
+	}
+}//_get_gap_for_matrix
 
 
 /**
 /**
  * Respond to Ajax dropdown call
  * Respond to Ajax dropdown call
  */
  */
-function ajax_example_dependent_dropdown_callback($form, $form_state) {
+function ajax_dependent_dropdown_callback($form, $form_state) {
   return $form['ALG']['SParam']['gapCost'];
   return $form['ALG']['SParam']['gapCost'];
 }
 }
 
 
@@ -987,6 +968,16 @@ function ajax_example_dependent_dropdown_callback($form, $form_state) {
  *   The current state fo the form passed in as $form.
  *   The current state fo the form passed in as $form.
  */
  */
 function blast_ui_tblastn_advanced_options_form(&$form, $form_state) {
 function blast_ui_tblastn_advanced_options_form(&$form, $form_state) {
+  $all_job_data = variable_get('job_data', '');
+  if (isset($_GET['jid']) && isset($all_job_data)) {    
+     $jid = base64_decode($_GET['jid']);
+     $job_data = $all_job_data[$jid];
+  }
+  else {
+    $job_data = array();
+    $jid = 0;
+  }
+  $defaults = _get_default_values($job_data, 'tblastn');
 
 
   $form['ALG']['GParam'] = array(
   $form['ALG']['GParam'] = array(
    '#type' => 'fieldset',
    '#type' => 'fieldset',
@@ -997,53 +988,313 @@ function blast_ui_tblastn_advanced_options_form(&$form, $form_state) {
   $form['ALG']['GParam']['maxTarget'] = array(
   $form['ALG']['GParam']['maxTarget'] = array(
     '#type' => 'select',
     '#type' => 'select',
     '#title' => t('Max target sequences:'),
     '#title' => t('Max target sequences:'),
-    '#options' => array(
-      0 => t('10'),
-      1 => t('50'),
-      2 => t('100'),
-      3 => t('250'),
-      4 => t('500'),
-      5 => t('1000'),
-      6 => t('5000'),
-      7 => t('10000'),
-      8 => t('20000'),
-    ),
-    '#default_value' => 2,
+    '#options' => _get_max_target('tblastn'),
+    '#default_value' => $defaults['max_target_seqs'],
     '#description' => t('Select the maximum number of aligned sequences to display'),
     '#description' => t('Select the maximum number of aligned sequences to display'),
   );
   );
 
 
   $form['ALG']['GParam']['eVal'] = array(
   $form['ALG']['GParam']['eVal'] = array(
     '#type' => 'textfield',
     '#type' => 'textfield',
     '#title' => t('e-Value (Expected Threshold)'),
     '#title' => t('e-Value (Expected Threshold)'),
-    '#default_value' => 10,
+    '#default_value' => $defaults['evalue'],
     '#size' => 12,
     '#size' => 12,
     '#maxlength' => 20,
     '#maxlength' => 20,
     '#description' => t('Expected number of chance matches in a random model. This number should be give in a decimal format. <a href="http://www.ncbi.nlm.nih.gov/BLAST/blastcgihelp.shtml#expect" target="_blank">More Information</a> | <a href="https://www.youtube.com/watch?v=nO0wJgZRZJs" target="_blank">Expect value vedio tutorial</a>'),
     '#description' => t('Expected number of chance matches in a random model. This number should be give in a decimal format. <a href="http://www.ncbi.nlm.nih.gov/BLAST/blastcgihelp.shtml#expect" target="_blank">More Information</a> | <a href="https://www.youtube.com/watch?v=nO0wJgZRZJs" target="_blank">Expect value vedio tutorial</a>'),
   );
   );
 
 
-}
+/*eksc- need to learn how this is implemented for tblastn
+  $form['ALG']['GParam']['shortQueries'] = array(
+    '#type' => 'checkbox',
+    '#title' => t('Automatically adjust parameters for short input sequences'),
+    '#default_value' => TRUE,
+  );
+*/
+
+  $form['ALG']['GParam']['wordSize'] = array(
+    '#type' => 'select',
+    '#title' => t('Word size:'),
+    '#options' => _get_word_size('tblastn'),
+    '#default_value' => $defaults['word_size'],
+    '#description' => t('The length of the seed that initiates an alignment'),
+  );
+
+  // Scoring parameters
+  //.........................
+
+  $form['ALG']['SParam'] = array(
+    '#type' => 'fieldset',
+    '#title' => t('Scoring parameters'),
+    '#collapsible' => FALSE,
+  );
+
+  $matrix_options = _get_matrix_options();
+  $form['ALG']['SParam']['Matrix'] = array(
+    '#type' => 'select',
+    '#title' => 'Matrix',
+    '#options' => $matrix_options,
+    '#default_value' => $defaults['matrix'],
+    '#description' => t('Assigns a score for aligning pairs of residues, and determines overall alignment score..'),
+    '#ajax' => array(
+      'callback' => 'ajax_dependent_dropdown_callback',
+      'wrapper' => 'dropdown-second-replace',
+    ),
+  );
+
+  $form['ALG']['SParam']['gapCost'] = array(
+    '#type' => 'select',
+    '#title' => t('Gap Costs:'),
+    '#prefix' => '<div id="dropdown-second-replace">',
+    '#suffix' => '</div>',
+    '#options' => _get_gap_for_matrix($$default['matrix']),
+    '#default_value' => 2,
+    '#description' => t('Cost to create and extend a gap in an alignment.'),
+  );
+
+  $form['ALG']['GParam']['qRange'] = array(
+    '#type' => 'textfield',
+    '#title' => t('Max matches in a query range'),
+    '#default_value' => $defaults['qRange'],
+    '#size' => 12,
+    '#maxlength' => 20,
+    '#description' => t('Limit the number of matches to a query range. This option is useful if many strong matches to one part of a query may prevent BLAST from presenting weaker matches to another part of the query.'),
+  );
+}//blast_ui_tblastn_advanced_options_form
 
 
 /**
 /**
- * Validate the advanced options provided by the BLASTn form above.
+ * Validate the advanced options provided by the tBLASTn form above.
  *
  *
  * @see blast_ui_tblastn_advanced_options_form().
  * @see blast_ui_tblastn_advanced_options_form().
  */
  */
 function blast_ui_tblastn_advanced_options_form_validate($form, $form_state) { }
 function blast_ui_tblastn_advanced_options_form_validate($form, $form_state) { }
 
 
 /**
 /**
- * Processed the advanced options provided by the yBLASTn form above.
+ * Processed the advanced options provided by the tBLASTn form above.
  *
  *
  * @see blast_ui_tblastn_advanced_options_form().
  * @see blast_ui_tblastn_advanced_options_form().
  */
  */
 function blast_ui_tblastn_advanced_options_form_submit($form, $form_state) {
 function blast_ui_tblastn_advanced_options_form_submit($form, $form_state) {
 
 
-  $eVal = $form_state['values']['eVal'];
+  return blast_ui_blastp_advanced_options_form_submit($form, $form_state);
 
 
-  $trgtKey = $form_state['values']['maxTarget'];
-  $numAlign = $form['ALG']['GParam']['maxTarget']['#options'][$trgtKey];
+}
 
 
+/*
+ * Get default form values; may come from saved job data if user is re-running
+ *   a previous job.
+ */
+function _get_default_values($job_data) {
+  // restore previous values or set to default
+  $max_target = (isset($job_data['options']['max_target_seqs'])) 
+  					? $job_data['options']['max_target_seqs'] : 10;
+  $short_queries = (isset($job_data['options']['shortQueries'])) 
+  					? $job_data['options']['shortQueries'] : true;
+  $evalue = (isset($job_data['options']['evalue'])) 
+  					? $job_data['options']['evalue'] : .001;
+  $word_size = (isset($job_data['options']['word_size'])) 
+  					? $job_data['options']['word_size'] : 11;
+  $qRange = (isset($job_data['options']['culling_limit'])) 
+  					? $job_data['options']['culling_limit'] : 0;
+
+  $matchmiss = 0;
+  $reward = (isset($job_data['options']['reward'])) 
+  					? $job_data['options']['reward'] : 1;
+  $penalty = (isset($job_data['options']['penalty'])) 
+  					? $job_data['options']['penalty'] : -2;
+  if ($reward == 1) {
+  	switch ($penalty) {
+  		case -1: $matchmiss = 5; break;
+  	  case -2: $matchmiss = 0; break;
+  	  case -3: $matchmiss = 1; break;
+  	  case -4: $matchmiss = 2; break;
+  	}
+  }
+  else if ($reward == 2) {
+  	$matchmiss = 3;
+  }
+  else if ($reward == 3) {
+  	 $matchmis = 4;
+  }
+  else if ($eward == 4) {
+  	 $matchmiss = 5;
+  }
+  
+  $gap = 0;
+  $gapopen = (isset($job_data['options']['gapopen'])) 
+  					? $job_data['options']['gapopen'] : 5;
+  $gapextend = (isset($job_data['options']['gapextend'])) 
+  					? $job_data['options']['gapextend'] : 2;
+  if ($gapextend == 2) {
+  	switch ($gapopen) {
+  		case 5: $gap = 0; break;
+  		case 2: $gap = 1; break;
+  		case 1: $gap = 2; break;
+  		case 0: $gap = 3; break;
+  	}
+  }
+  else if ($gapextend == 1) {
+  	switch ($gapopen) {
+  		case 3: $gap = 4;
+  		case 2: $gap = 5;
+  		case 1: $gap = 6;
+  	}
+  }
+  
+// eksc- need to implement query range limit
+//  $q_range = 0;
+  
+  $matrix = (isset($job_data['options']['matrix'])) 
+  					? $job_data['options']['matrix'] : 'PAM30';
   return array(
   return array(
-    'evalue' => $eVal,
+  	'max_target_seqs' => $max_target,
+  	'short_queries'   => $short_queries,
+  	'word_size'       => $word_size,
+  	'evalue'          => $evalue,
+  	'matchmiss'       => $matchmiss,
+  	'gap'             => $gap,
+  	'qRange'          => $qRange,
+    'matrix'          => $matrix,
   );
   );
+}//_get_default_values
+
+function _get_max_target($which) {
+	switch ($which) {
+	  case 'blastn':
+	  case 'blastx':
+	  case 'blastp':
+	  case 'tblastn':
+			return array(
+				10 => t('10'),
+				50 => t('50'),
+				100 => t('100'),
+				250 => t('250'),
+				500 => t('500'),
+				1000 => t('1000'),
+				5000 => t('5000'),
+				10000 => t('10000'),
+				20000 => t('20000'),
+			);
+	}//switch
+}
+
+function _get_word_size($which) {
+	switch ($which) {
+		case 'blastn':
+			 return array(
+				 7 => t('7'),  
+				 11 => t('11'),
+				 15 => t('15'),
+				 16 => t('16'),
+				 20 => t('20'),
+				 24 => t('24'),
+				 28 => t('28'),
+				 32 => t('32'),
+				 48 => t('48'),
+				 64 => t('64'),
+			 	 128 => t('128'),
+				 256 => t('256'),
+	    );
+    case 'blastx':
+    case 'blastp':
+    case 'tblastn':
+    	return array(
+        2 => t('2'),
+        3 => t('3'),
+        6 => t('6'),
+      );
+	}//switch
+}
+
+function _get_match_mismatch($which) {
+	switch ($which) {
+		case 'blastn':
+      return array(
+				 0 => t('1,-2'),
+				 1 => t('1,-3'),
+				 2 => t('1,-4'),
+				 3 => t('2,-3'),
+				 4 => t('4,-5'),
+				 5 => t('1,-1'),
+      );
+  }//switch
+}
 
 
+function _get_gap($which) {
+	switch ($which) {
+		case 'blastn':
+      return array(
+				0 => t('Existence: 5 Extension: 2'),
+				1 => t('Existence: 2 Extension: 2'),
+				2 => t('Existence: 1 Extension: 2'),
+				3 => t('Existence: 0 Extension: 2'),
+				4 => t('Existence: 3 Extension: 1'),
+				5 => t('Existence: 2 Extension: 1'),
+				6 => t('Existence: 1 Extension: 1'),
+      );
+   }//switch
 }
 }
+
+function _set_gap($gap_key) {
+ switch ($gap_key) {
+   case 0:
+      $gapOpen = 5;
+      $gapExtend = 2;
+      break;
+   case 1:
+      $gapOpen = 2;
+      $gapExtend = 2;
+      break;
+   case 2:
+      $gapOpen = 1;
+      $gapExtend = 2;
+      break;
+   case 3:
+      $gapOpen = 0;
+      $gapExtend = 2;
+      break;
+   case 4:
+      $gapOpen = 3;
+      $gapExtend = 1;
+      break;
+   case 5:
+      $gapOpen = 2;
+      $gapExtend = 1;
+      break;
+   case 6:
+      $gapOpen = 1;
+      $gapExtend = 1;
+      break;
+  }//switch
+  
+  return array('gapOpen' => $gapOpen, 'gapExtend' => $gapExtend);
+}
+
+function _set_match_mismatch($m_m) {
+  switch ($m_m) {
+   case 0:
+      $penalty = -2;
+      $reward = 1;
+      break;
+   case 1:
+      $penalty = -3;
+      $reward = 1;
+      break;
+   case 2:
+      $penalty = -4;
+      $reward = 1;
+      break;
+   case 3:
+      $penalty = -3;
+      $reward = 2;
+      break;
+   case 4:
+      $penalty = -5;
+      $reward = 4;
+      break;
+   case 5:
+      $penalty = -1;
+      $reward = 1;
+      break;
+  }//switch
+  
+  return array('penalty' => $penalty, 'reward' => $reward);
+}

+ 142 - 96
includes/blast_ui.form_per_program.inc

@@ -15,20 +15,22 @@
  */
  */
 function blast_ui_per_blast_program_form($form, $form_state) {
 function blast_ui_per_blast_program_form($form, $form_state) {
 
 
-	//  CSS support to the form
-	$form['#attached']['css'] = array(
-		drupal_get_path('module', 'blast_ui') . '/theme/css/form.css',
-	);
-	
+  //  CSS support to the form
+  $form['#attached']['css'] = array(
+    drupal_get_path('module', 'blast_ui') . '/theme/css/form.css',
+  );
+  
   // @deepaksomanadh - Code added for edit and resubmit funcitonality
   // @deepaksomanadh - Code added for edit and resubmit funcitonality
-	// 	Approach: persist the form data and read it back using JobID
-	$job_data = variable_get('job_data', '');
-	if(isset($_GET['jid']) && isset($job_data)) {		
-			$jid = base64_decode($_GET['jid']);
-	}	else {
-			$job_data = array();
-			$jid = 0;
-	}
+  //   Approach: persist the form data and read it back using JobID
+  $job_data = variable_get('job_data', '');
+  if (isset($_GET['jid']) && isset($job_data)) {    
+    $jid = base64_decode($_GET['jid']);
+  }  
+  else {
+    $job_data = array();
+    $jid = 0;
+  }
+  
   // Determine the BLAST program.
   // Determine the BLAST program.
   $query_type = $form_state['build_info']['args'][0];
   $query_type = $form_state['build_info']['args'][0];
   $db_type = $form_state['build_info']['args'][1];
   $db_type = $form_state['build_info']['args'][1];
@@ -99,8 +101,8 @@ function blast_ui_per_blast_program_form($form, $form_state) {
     '#prefix' => '<span style="float: right;">',
     '#prefix' => '<span style="float: right;">',
     '#suffix' => '</span>',
     '#suffix' => '</span>',
     '#ajax' => array(
     '#ajax' => array(
-    	'callback' => 'ajax_blast_ui_example_sequence_callback',
-    	'wrapper'  => 'fasta-textarea',
+      'callback' => 'ajax_blast_ui_example_sequence_callback',
+      'wrapper'  => 'fasta-textarea',
       'method'   => 'replace',
       'method'   => 'replace',
       'effect'   => 'fade',
       'effect'   => 'fade',
     ),
     ),
@@ -111,18 +113,19 @@ function blast_ui_per_blast_program_form($form, $form_state) {
     '#type' => 'textarea',
     '#type' => 'textarea',
     '#title' => t('Enter FASTA sequence(s)'),
     '#title' => t('Enter FASTA sequence(s)'),
     '#description'=>t('Enter query sequence(s) in the text area.'),
     '#description'=>t('Enter query sequence(s) in the text area.'),
-		'#default_value' => isset($job_data[$jid]['fasta']) ? $job_data[$jid]['fasta'] : '',
+    '#default_value' => isset($job_data[$jid]['fasta']) ? $job_data[$jid]['fasta'] : '',
     '#prefix' => '<div id="fasta-textarea">',
     '#prefix' => '<div id="fasta-textarea">',
     '#suffix' => '</div>',
     '#suffix' => '</div>',
   );
   );
 
 
+/*TODO: FIX THIS! Shouldn't come up if not selected in configuration
   // Upload a file as an alternative to enter a query sequence
   // Upload a file as an alternative to enter a query sequence
   $form['#attributes']['enctype'] = 'multipart/form-data';
   $form['#attributes']['enctype'] = 'multipart/form-data';
   $form['query']['UPLOAD'] = array(
   $form['query']['UPLOAD'] = array(
-    '#title' => 'Or upload your own query FASTA:	',
+    '#title' => 'Or upload your own query FASTA:  ',
     '#type' => 'managed_file',
     '#type' => 'managed_file',
     '#description' => t('The file should be a plain-text FASTA
     '#description' => t('The file should be a plain-text FASTA
-(.fasta, .fna, .fa) file. In other words, it cannot have formatting as is the
+(.fasta, .fna, .fa, .fas) file. In other words, it cannot have formatting as is the
 case with MS Word (.doc, .docx) or Rich Text Format (.rtf). It cannot be greater
 case with MS Word (.doc, .docx) or Rich Text Format (.rtf). It cannot be greater
 than %max_size in size. <strong>Don\'t forget to press the Upload button before
 than %max_size in size. <strong>Don\'t forget to press the Upload button before
 attempting to submit your BLAST.</strong>',
 attempting to submit your BLAST.</strong>',
@@ -131,10 +134,11 @@ attempting to submit your BLAST.</strong>',
       )
       )
     ),
     ),
     '#upload_validators' => array(
     '#upload_validators' => array(
-      'file_validate_extensions' => array('fasta fna fa'),
+      'file_validate_extensions' => array('fasta fna fa fas'),
       'file_validate_size' => array(file_upload_max_size()),
       'file_validate_size' => array(file_upload_max_size()),
     ),
     ),
   );
   );
+*/
 
 
 
 
   // BLAST DATABASE
   // BLAST DATABASE
@@ -142,7 +146,7 @@ attempting to submit your BLAST.</strong>',
 
 
   $form['DB'] = array(
   $form['DB'] = array(
     '#type' => 'fieldset',
     '#type' => 'fieldset',
-    '#title' => t('Choose Search Set'),
+    '#title' => t('Choose Search Target'),
     '#description' => t('Choose from one of the %type BLAST databases listed '
     '#description' => t('Choose from one of the %type BLAST databases listed '
       . 'below. You can also use the browse button to upload a file from your '
       . 'below. You can also use the browse button to upload a file from your '
       . 'local disk. The file may contain a single sequence or a list of '
       . 'local disk. The file may contain a single sequence or a list of '
@@ -164,7 +168,7 @@ attempting to submit your BLAST.</strong>',
     // Upload a file as an alternative to selecting an existing BLAST database
     // Upload a file as an alternative to selecting an existing BLAST database
     $form['#attributes']['enctype'] = 'multipart/form-data';
     $form['#attributes']['enctype'] = 'multipart/form-data';
     $form['DB']['DBUPLOAD'] = array(
     $form['DB']['DBUPLOAD'] = array(
-      '#title' => 'Or upload your own dataset:	',
+      '#title' => 'Or upload your own dataset:  ',
       '#type' => 'managed_file',
       '#type' => 'managed_file',
       '#description' => t('The file should be a plain-text FASTA
       '#description' => t('The file should be a plain-text FASTA
   (.fasta, .fna, .fa) file. In other words, it cannot have formatting as is the
   (.fasta, .fna, .fa) file. In other words, it cannot have formatting as is the
@@ -175,6 +179,7 @@ attempting to submit your BLAST.</strong>',
           '%max_size' => round(file_upload_max_size() / 1024 / 1024,1) . 'MB'
           '%max_size' => round(file_upload_max_size() / 1024 / 1024,1) . 'MB'
         )
         )
       ),
       ),
+      '#default_value' => variable_get($db_file_id, ''),
       '#upload_validators' => array(
       '#upload_validators' => array(
         'file_validate_extensions' => array('fasta fna fa'),
         'file_validate_extensions' => array('fasta fna fa'),
         'file_validate_size' => array(file_upload_max_size()),
         'file_validate_size' => array(file_upload_max_size()),
@@ -206,6 +211,12 @@ attempting to submit your BLAST.</strong>',
     '#default_value' => ' BLAST ',
     '#default_value' => ' BLAST ',
   );
   );
 
 
+  // Recent jobs list
+  $form['recentjobs'] = array(
+     '#type' => 'fieldset',
+     '#prefix' => get_recent_jobs(),
+   );
+   
   return $form;
   return $form;
 }
 }
 
 
@@ -216,7 +227,6 @@ attempting to submit your BLAST.</strong>',
  */
  */
 function blast_ui_per_blast_program_form_validate($form, &$form_state) {
 function blast_ui_per_blast_program_form_validate($form, &$form_state) {
 
 
-
   $blast_program = $form_state['values']['blast_program'];
   $blast_program = $form_state['values']['blast_program'];
 
 
   $type = $form_state['values']['query_type'];
   $type = $form_state['values']['query_type'];
@@ -305,7 +315,8 @@ function blast_ui_per_blast_program_form_validate($form, &$form_state) {
     );
     );
   }
   }
 
 
-}
+}//blast_ui_per_blast_program_form_validate
+
 
 
 /**
 /**
  * Process the user options submitted via the blast program form.
  * Process the user options submitted via the blast program form.
@@ -317,29 +328,27 @@ function blast_ui_per_blast_program_form_submit($form, &$form_state) {
   $error = FALSE;
   $error = FALSE;
   $blast_program = $form_state['values']['blast_program'];
   $blast_program = $form_state['values']['blast_program'];
 
 
-    if ($form_state['values']['db_type'] == 'nucleotide') {
-      $mdb_type = 'nucl';
-      $file_suffix = '.nsq';
-    }
-    else {
-      $mdb_type = 'prot';
-      $file_suffix = '.psq';
-    }
+  if ($form_state['values']['db_type'] == 'nucleotide') {
+    $mdb_type = 'nucl';
+  }
+  else {
+    $mdb_type = 'prot';
+  }
 
 
   // If the query was submitted via the texrfield then create a file containing it
   // If the query was submitted via the texrfield then create a file containing it
-  if ( isset($form_state['qFlag']) ) {
-    if ( $form_state['qFlag'] == 'seqQuery' ) {
+  if (isset($form_state['qFlag'])) {
+    if ($form_state['qFlag'] == 'seqQuery') {
       $seq_content = $form_state['values']['FASTA'];
       $seq_content = $form_state['values']['FASTA'];
-	    $query = '/tmp/' . date('YMd_His') . '_query.fasta';
-      file_put_contents ( $query , $seq_content);
+      $query = '/tmp/' . date('YMd_His') . '_query.fasta';
+      file_put_contents ($query , $seq_content);
     }
     }
-    elseif ( $form_state['qFlag'] == 'upQuery' ) {
+    elseif ($form_state['qFlag'] == 'upQuery') {
       $query = $form_state['upQuery_path'];
       $query = $form_state['upQuery_path'];
     }
     }
   }
   }
 
 
   // If the BLAST database was uploaded then use it to run the BLAST
   // If the BLAST database was uploaded then use it to run the BLAST
-  if ( $form_state['dbFlag'] == 'upDB') {
+  if ($form_state['dbFlag'] == 'upDB') {
 
 
     // Since we only support using the -db flag (not -subject) we need to create a
     // Since we only support using the -db flag (not -subject) we need to create a
     // blast database for the FASTA uploaded.
     // blast database for the FASTA uploaded.
@@ -361,19 +370,18 @@ your sequence headers include pipes (i.e.: | ) they adhere to '
 
 
       $error = TRUE;
       $error = TRUE;
     }
     }
-
-  }
+  }//upload target db
+  
   // Otherwise, we are using one of the website provided BLAST databases so form the
   // Otherwise, we are using one of the website provided BLAST databases so form the
   // BLAST command accordingly
   // BLAST command accordingly
   elseif ($form_state['dbFlag'] == 'blastdb') {
   elseif ($form_state['dbFlag'] == 'blastdb') {
-
     $selected_db = $form_state['values']['SELECT_DB'];
     $selected_db = $form_state['values']['SELECT_DB'];
     $blastdb_node = node_load($selected_db);
     $blastdb_node = node_load($selected_db);
+    $blastdb_name = $blastdb_node->db_name;
     $blastdb_with_path = $blastdb_node->db_path;
     $blastdb_with_path = $blastdb_node->db_path;
-
   }
   }
 
 
-  // Now let each program process it's own advanced options.
+  // Now let each program process its own advanced options.
   $advanced_options = array();
   $advanced_options = array();
   $advanced_options_form_submit = 'blast_ui_' . $blast_program . '_advanced_options_form_submit';
   $advanced_options_form_submit = 'blast_ui_' . $blast_program . '_advanced_options_form_submit';
   if (function_exists($advanced_options_form_submit)) {
   if (function_exists($advanced_options_form_submit)) {
@@ -382,12 +390,38 @@ your sequence headers include pipes (i.e.: | ) they adhere to '
       array($form, &$form_state)
       array($form, &$form_state)
     );
     );
   }
   }
+  else {
+  	$advanced_options = array('none' => 0);
+  }
+
+  // Set path to a BLAST target file to check for its existence
+  if ($mdb_type == 'nucl' && (preg_match('/\.[pn]al/', $blastdb_with_path) == 0)) {  
+    // Suffix may be .nsq or .nal
+    if (is_readable("$blastdb_with_path.nsq")) {
+      $blastdb_with_suffix = "$blastdb_with_path.nsq";
+    }
+    else if (is_readable("$blastdb_with_path.nal")) {
+      $blastdb_with_suffix = "$blastdb_with_path.nal";
+    }
+  }  
+  else if ($mdb_type == 'prot' && (preg_match('/\.[pn]al/', $blastdb_with_path) == 0)) {
+    // Suffix may be .psq or .pal
+    if (is_readable("$blastdb_with_path.psq")) {
+      $blastdb_with_suffix = "$blastdb_with_path.psq";
+    }
+    else if (is_readable("$blastdb_with_path.pal")) {
+      $blastdb_with_suffix = "$blastdb_with_path.pal";
+    }
+  }
+  else {
+    $blastdb_with_suffix = $blastdb_with_path;
+  }    
 
 
   // Actually submit the BLAST Tripal Job
   // Actually submit the BLAST Tripal Job
-  // NOTE: Tripal jobs needs to be executed from the command-line before it will be run!!
-  $blastdb_with_suffix = $blastdb_with_path . $file_suffix;
   if (is_readable($blastdb_with_suffix)) {
   if (is_readable($blastdb_with_suffix)) {
+    // BLAST target exists.
     global $user;
     global $user;
+
     $output_filestub = date('YMd_His');
     $output_filestub = date('YMd_His');
     $job_args = array(
     $job_args = array(
       'program' => $blast_program,
       'program' => $blast_program,
@@ -396,6 +430,7 @@ your sequence headers include pipes (i.e.: | ) they adhere to '
       'output_filename' => $output_filestub,
       'output_filename' => $output_filestub,
       'options' => $advanced_options
       'options' => $advanced_options
     );
     );
+    
     $job_id = tripal_add_job(
     $job_id = tripal_add_job(
       t('BLAST (@program): @query', array('@program' => $blast_program, '@query' => $query)),
       t('BLAST (@program): @query', array('@program' => $blast_program, '@query' => $query)),
       'blast_job',
       'blast_job',
@@ -403,62 +438,73 @@ your sequence headers include pipes (i.e.: | ) they adhere to '
       $job_args,
       $job_args,
       $user->uid
       $user->uid
     );
     );
-		//@deepaksomanadh Persist the important data for edit and resubmit
-		$job_data = variable_get('job_data', '');
-		$seq_rows = explode(PHP_EOL, $seq_content);
-		foreach($seq_rows as $row) {
-			if(strpos($row, ">") !== FALSE) {
-				$query_def[] = ltrim($row, ">");
-			}
-		}
-	
-		$job_data[$job_id] = 
-			array(
-				'program' => $blast_program,
-				'job_url' => current_path(),
-				'fasta' => $seq_content,
-				'query_def' => $query_def,
-				'db_name' => $blastdb_node->db_name,
-				'db_option' => $selected_db,
-				'options' => $advanced_options,
-			);
-		
-		variable_set('job_data', $job_data);
-		//@deepaksomanadh create session and save the recent jobs in respective session
-		if (session_status() === PHP_SESSION_NONE){
-					session_start();
-			}
-		$sid = session_id();
-		$job_encode_id = base64_encode($job_id);
-		$job_url = "blast/report/$job_encode_id";
-
-		$all_jobs = $_SESSION['all_jobs'];
-		
-		$session_jobs = $all_jobs[$sid];
-		$session_jobs[$job_id] = array(
-															'job_output_url'=> $job_url, 
-															'query_defs' => $query_def,
-															'program' => $blast_program,
-														 );
-		$all_jobs[$sid] = $session_jobs;
-		$_SESSION['all_jobs'] = $all_jobs;
-	
-		tripal_jobs_launch(1, $job_id);
-		//Encode the job_id
-		$job_encode_id = base64_encode($job_id);
+    
+    $job_data = variable_get('job_data', '');
+    $seq_rows = explode(PHP_EOL, $seq_content);
+    foreach($seq_rows as $row) {
+      if (strpos($row, ">") !== FALSE) {
+       $query_def[] = trim($row, "> \t\n\r\0\x0B");
+      }
+    }
+  
+    $job_data[$job_id] = 
+      array(
+        'program'   => $blast_program,
+        'job_url'   => current_path(),
+        'fasta'     => $seq_content,
+        'query_def' => $query_def,
+        'db_name'   => $blastdb_node->db_name,
+        'db_option' => $selected_db,
+        'options'   => $advanced_options,
+      );
+    
+    variable_set('job_data', $job_data);
+    //@deepaksomanadh create session and save the recent jobs in respective session
+    if (session_status() === PHP_SESSION_NONE) {
+       session_start();
+    }
+    $sid = session_id();
+    $job_encode_id = base64_encode($job_id);
+    $job_url = "blast/report/$job_encode_id";
+
+    $all_jobs = $_SESSION['all_jobs'];
+    
+    $session_jobs = $all_jobs[$sid];
+    $session_jobs[$job_id] = 
+      array(
+        'job_output_url'=> $job_url, 
+        'query_defs'    => $query_def,
+        'target'        => $blastdb_name,
+        'program'       => $blast_program,
+        'date'          => date('Y-M-d h:i:s'),
+       );
+    $all_jobs[$sid] = $session_jobs;
+    $_SESSION['all_jobs'] = $all_jobs;
+  
+// Comment out this line to run BLAST by hand via the command:
+//   drush trp-run-jobs --username=admin 
+    tripal_jobs_launch(1, $job_id);
+    
+    //Encode the job_id
+    $job_encode_id = base64_encode($job_id);
+    
     // Redirect to the BLAST results page
     // Redirect to the BLAST results page
     drupal_goto("blast/report/$job_encode_id");
     drupal_goto("blast/report/$job_encode_id");
-  }
-  // We check if $error is set to TRUE because if so then the error has already
-  // been reported.
-  elseif (!$error) {
-    $dbfile_uploaded_msg = ($form_state['dbFlag'] == 'upDB') ? 'The BLAST database was submitted via user upload.' : 'Existing BLAST Database was chosen';
+  }//BLAST target is readable
+  
+  // BLAST target is unreadable
+  else {
+    $dbfile_uploaded_msg = ($form_state['dbFlag'] == 'upDB') 
+        ? 'The BLAST database was submitted via user upload.' 
+        : 'Existing BLAST Database was chosen.';
     tripal_report_error(
     tripal_report_error(
       'blast_ui',
       'blast_ui',
       TRIPAL_ERROR,
       TRIPAL_ERROR,
-      "BLAST database %db unaccessible. $dbfile_uploaded_msg",
-      array('%db' => $blastdb_with_path)
+      "BLAST database %db unaccessible. %msg",
+      array('%db' => $blastdb_with_path, '%msg' => $dbfile_uploaded_msg)
     );
     );
-    drupal_set_message('BLAST database unaccessible. Please contact the site administrator.','error');
+    $msg = "$dbfile_uploaded_msg BLAST database '$blastdb_with_path' is unaccessible. ";
+    $msg .= "Please contact the site administrator.";
+    drupal_set_message($msg, 'error');
   }
   }
-}
+}//blast_ui_per_blast_program_form_submit

+ 20 - 3
includes/blast_ui.linkouts.inc

@@ -52,6 +52,7 @@
  * human-readable name to be used in the Blast Database add/edit form and the
  * human-readable name to be used in the Blast Database add/edit form and the
  * function to be used to determine the URL for each hit in BLAST results.
  * function to be used to determine the URL for each hit in BLAST results.
  */
  */
+
 function blast_ui_blast_linkout_info() {
 function blast_ui_blast_linkout_info() {
   $types = array();
   $types = array();
 
 
@@ -75,6 +76,11 @@ function blast_ui_blast_linkout_info() {
     'process function' => 'tripal_blast_generate_linkout_jbrowse',
     'process function' => 'tripal_blast_generate_linkout_jbrowse',
   );
   );
 
 
+  $types['custom'] = array(
+    'name' => 'Custom',
+    'process function' => 'tripal_custom_generate_linkout',
+  );
+
   return $types;
   return $types;
 }
 }
 
 
@@ -143,13 +149,24 @@ function tripal_blast_generate_linkout_gbrowse($url_prefix, $hit, $info, $option
   $ranges = array();
   $ranges = array();
   $coords = array();
   $coords = array();
   foreach($info['HSPs'] as $hsp) {
   foreach($info['HSPs'] as $hsp) {
-     array_push($ranges,$hsp['Hsp_hit-from'] . '..' . $hsp['Hsp_hit-to'] );
-     array_push($coords,$hsp['Hsp_hit-from'] , $hsp['Hsp_hit-to'] );
+     $start = min($hsp['Hsp_hit-from'], $hsp['Hsp_hit-to']);
+     $stop = max($hsp['Hsp_hit-from'], $hsp['Hsp_hit-to']);
+     array_push($ranges, "$start..$stop");
+     array_push($coords, $start, $stop);
    }
    }
    $min = min($coords);
    $min = min($coords);
    $max = max($coords);
    $max = max($coords);
    $joined_ranges = join ("," , $ranges);
    $joined_ranges = join ("," , $ranges);
-   $url_postfix = '&start=' . $min . '&stop='  . $max . '&add=' . $hit->{'hit_name'} . '+BLAST+' . $hit->{'hit_name'} . '_' . $info['query_name'] . '_' . $info['e-value'] . '+' . $joined_ranges ;
+//   $track_name = $hit->{'hit_name'} . '_' . $info['query_name'] . '_' . $info['e-value'];
+   $track_name = $hit->{'linkout_id'} . '_' . $info['query_name'] . '_' . $info['e-value'];
+   
+//   $url_postfix = 'query=';
+   $url_postfix = 'start=' . $min . ';stop=' . $max;
+//   $url_postfix .= ';ref=' . $hit->{'hit_name'};
+//   $url_postfix .= ';add=' . $hit->{'hit_name'} . '+BLAST+Query+' . $joined_ranges;
+   $url_postfix .= ';ref=' . $hit->{'linkout_id'};
+   $url_postfix .= ';add=' . $hit->{'linkout_id'} . '+BLAST+Query+' . $joined_ranges;
+   $url_postfix .= ';h_feat=Query';
 
 
    return $url_prefix . $url_postfix;
    return $url_prefix . $url_postfix;
 }
 }

+ 43 - 24
includes/blast_ui.node.inc

@@ -175,7 +175,8 @@ function blastdb_form($node, &$form_state) {
     '#description' => 'The external database you would like to link-out to. '
     '#description' => 'The external database you would like to link-out to. '
       . 'Note that this list includes all Tripal Databases and if the database '
       . 'Note that this list includes all Tripal Databases and if the database '
       . 'you would like to link-out to is not included you can add it through '
       . 'you would like to link-out to is not included you can add it through '
-      . l('Administration > Tripal > Chado Modules > Databases','admin/tripal/chado/tripal_db/add', array('attributes' => array('target' => '_blank'))) . '.',
+      . l('Administration > Tripal > Chado Modules > Databases','admin/tripal/chado/tripal_db/add', array('attributes' => array('target' => '_blank')))
+      . '.',
     '#options' => $db_options,
     '#options' => $db_options,
     '#default_value' => (isset($node->linkout->db_id->db_id)) ? $node->linkout->db_id->db_id : 0
     '#default_value' => (isset($node->linkout->db_id->db_id)) ? $node->linkout->db_id->db_id : 0
   );
   );
@@ -188,7 +189,14 @@ function blastdb_form($node, &$form_state) {
   $form['dbxref']['dbxref_linkout_type'] = array(
   $form['dbxref']['dbxref_linkout_type'] = array(
     '#type' => 'select',
     '#type' => 'select',
     '#title' => 'Link-out Type',
     '#title' => 'Link-out Type',
-    '#description' => 'This determines how the URL to be linked to is formed. NOTE: this is very dependant on the External Database chosen above since it needs to be able to support the type of linking choosen. For example, only External Databases which reference a GBrowse instance can use the GBrowse link type.',
+    '#description' => 'This determines how the URL to be linked to is formed. '
+                    . 'NOTE: this is very dependant on the External Database '
+                    . 'chosen above since it needs to be able to support the '
+                    . 'type of linking choosen. For example, only External '
+                    . 'Databases which reference a GBrowse instance can use the '
+                    . 'GBrowse link type.  If a link requires customized code, '
+                    . 'select "custom" and add the code to the file ' 
+                    . 'includes/blast_ui.custom/inc.',
     '#options' => $options,
     '#options' => $options,
     '#default_value' => (isset($node->linkout->type)) ? $node->linkout->type : 'link'
     '#default_value' => (isset($node->linkout->type)) ? $node->linkout->type : 'link'
   );
   );
@@ -234,7 +242,7 @@ function blastdb_form_validate($form, $form_state) {
  */
  */
 function blastdb_insert($node) {
 function blastdb_insert($node) {
 
 
-  // Hangle Link-out Rules.
+  // Handle Link-out Rules.
   if ($node->dbxref_id_type == 'custom') {
   if ($node->dbxref_id_type == 'custom') {
     $regex = $node->regex;
     $regex = $node->regex;
   }
   }
@@ -242,17 +250,20 @@ function blastdb_insert($node) {
     $regex = $node->dbxref_id_type;
     $regex = $node->dbxref_id_type;
   }
   }
 
 
+  if (!$node->dbxref_linkout_type) {
+    $node->dbxref_linkout_type = 'link';
+  }
+  
   // Actually insert the record.
   // Actually insert the record.
   db_insert('blastdb')->fields(array(
   db_insert('blastdb')->fields(array(
-    'nid' => $node->nid,
-    'name' => $node->db_name,
-    'path' => $node->db_path,
-    'dbtype' => $node->db_dbtype,
-    'dbxref_id_regex' => $regex,
-    'dbxref_db_id' => $node->db_id,
-    'dbxref_linkout_type' => $node->dbxref_linkout_type
+    'nid'                 => $node->nid,
+    'name'                => $node->db_name,
+    'path'                => $node->db_path,
+    'dbtype'              => $node->db_dbtype,
+    'dbxref_id_regex'     => $regex,
+    'dbxref_db_id'        => $node->db_id,
+    'dbxref_linkout_type' => $node->dbxref_linkout_type,
   ))->execute();
   ))->execute();
-
 }
 }
 
 
 /**
 /**
@@ -270,7 +281,7 @@ function blast_ui_node_insert($node) {
  */
  */
 function blastdb_update($node) {
 function blastdb_update($node) {
 
 
-  // Hangle Link-out Rules.
+  // Handle Link-out Rules.
   if ($node->dbxref_id_type == 'custom') {
   if ($node->dbxref_id_type == 'custom') {
     $regex = $node->regex;
     $regex = $node->regex;
   }
   }
@@ -278,23 +289,27 @@ function blastdb_update($node) {
     $regex = $node->dbxref_id_type;
     $regex = $node->dbxref_id_type;
   }
   }
 
 
-  // Actually insert the record.
+  if (!$node->dbxref_linkout_type) {
+    $node->dbxref_linkout_type = 'link';
+  }
+  
+  // Update the record.
   db_update('blastdb')->fields(array(
   db_update('blastdb')->fields(array(
-    'name' => $node->db_name,
-    'path' => $node->db_path,
-    'dbtype' => $node->db_dbtype,
-    'dbxref_id_regex' => $regex,
-    'dbxref_db_id' => $node->db_id,
-    'dbxref_linkout_type' => $node->dbxref_linkout_type
+    'name'                => $node->db_name,
+    'path'                => $node->db_path,
+    'dbtype'              => $node->db_dbtype,
+    'dbxref_id_regex'     => $regex,
+    'dbxref_db_id'        => $node->db_id,
+    'dbxref_linkout_type' => $node->dbxref_linkout_type,
   ))->condition('nid', $node->nid)->execute();
   ))->condition('nid', $node->nid)->execute();
 }
 }
 
 
 /**
 /**
  * Implements hook_node_update().
  * Implements hook_node_update().
- * This	function acts on ALL NODES
+ * This  function acts on ALL NODES
  */
  */
 function blast_ui_node_update($node) {
 function blast_ui_node_update($node) {
-  if ($node->type == 'blastdb')	{
+  if ($node->type == 'blastdb')  {
     $node->title = $node->db_name;
     $node->title = $node->db_name;
   }
   }
 }
 }
@@ -303,7 +318,7 @@ function blast_ui_node_update($node) {
  * Implements hook_delete().
  * Implements hook_delete().
  */
  */
 function blastdb_delete($node) {
 function blastdb_delete($node) {
-   db_delete('blastdb')->condition('nid',$node->nid)->execute();
+  db_delete('blastdb')->condition('nid',$node->nid)->execute();
 }
 }
 
 
 /**
 /**
@@ -311,7 +326,12 @@ function blastdb_delete($node) {
  */
  */
 function blastdb_load($nodes) {
 function blastdb_load($nodes) {
 
 
-  $result = db_query('SELECT nid, name, path, dbtype, dbxref_id_regex, dbxref_db_id, dbxref_linkout_type FROM {blastdb} WHERE nid IN (:nids)', array(':nids' => array_keys($nodes)));
+  $sql = "
+    SELECT nid, name, path, dbtype, dbxref_id_regex, dbxref_db_id, 
+           dbxref_linkout_type
+    FROM {blastdb} 
+    WHERE nid IN (:nids)";
+  $result = db_query($sql, array(':nids' => array_keys($nodes)));
 
 
   foreach ($result as $record) {
   foreach ($result as $record) {
     $nodes[$record->nid]->db_name = $record->name;
     $nodes[$record->nid]->db_name = $record->name;
@@ -356,7 +376,6 @@ function blastdb_load($nodes) {
       $nodes[$record->nid]->linkout->none = TRUE;
       $nodes[$record->nid]->linkout->none = TRUE;
     }
     }
   }
   }
-
 }
 }
 
 
 /**
 /**

+ 192 - 0
includes/blast_ui.services.inc

@@ -0,0 +1,192 @@
+<?php
+function blast_ui_services_resources() {
+  return array(
+    'blast' => array(
+      'retrieve' => array(
+        'help' => 'Retrieves a blast_ui',       
+        'callback' => '_blast_ui_retrieve',
+         'access callback' => 'user_access',
+        'access arguments' => array('access user profiles'),
+        'args' => array(),
+      ),
+      'create' => array(
+        'help' => 'Creates a blast_ui',
+        'callback' => '_blast_ui_create',
+        'access arguments' => array('access content'),
+        'access arguments append' => false,
+        'args' => array(
+           array(
+              'name' => 'param',
+              'type' => 'array',
+              'description' => 'The node information',
+              'source' => 'data',
+              'optional' => FALSE,
+          ),
+        ),
+      ),
+        'update' => array(
+        'help' => 'Updates a blast_ui',
+        'callback' => '_blast_ui_update',
+       'access callback' => 'user_access',
+        'access arguments' => array('access user profiles'),
+        'args' => array(
+          array(
+            'name' => 'id',
+            'type' => 'int',
+            'description' => 'The id of the node to update',
+            'source' => array('path' => '0'),
+            'optional' => FALSE,
+          ),
+          array(
+            'name' => 'data',
+            'type' => 'struct',
+            'description' => 'The node data object',
+            'source' => 'data',
+            'optional' => FALSE,
+          ),
+        ),
+      ),
+      'delete' => array(
+        'help' => 'Deletes a blast_ui',
+        'callback' => '_blast_ui_delete',
+         'access callback' => 'user_access',
+       'access arguments' => array('access content'),
+        'access arguments append' => TRUE,
+        'args' => array(
+          array(
+            'name' => 'nid',
+            'type' => 'int',
+            'description' => 'The id of the note to delete',
+            'source' => array('path' => '0'),
+            'optional' => FALSE,
+          ),
+        ),
+      ),
+      'index' => array(
+        'help' => 'Retrieves a listing of blast_ui',
+        'callback' => '_blast_ui_index',
+        'access callback' => 'user_access',
+        'access arguments' => array('access content'),
+        'access arguments append' => FALSE,
+        'args' => array(),
+        ),
+     
+       'actions' => array(
+    	'getDatabaseType' => array(
+    	'help' => 'Retrieves a listing of database',
+        'callback' => '_blast_ui_getDatabaseType',
+        'access callback' => 'user_access',
+        'access arguments' => array('access content'),
+        'access arguments append' => FALSE,
+        'args' => array(),
+         ),
+         'getDatabaseOptions' => array(
+    	'help' => 'Retrieves a listing of database',
+        'callback' => '_blast_ui_getDatabaseOption',
+        'access callback' => 'user_access',
+        'access arguments' => array('access content'),
+        'access arguments append' => FALSE,
+        'args' => array(),
+         ),
+        ),
+       ),
+   );
+    
+}
+
+
+
+
+
+function _blast_ui_create($param) {
+  
+ return services_error('Missing _blast_ui_create', 406);
+}
+
+
+/**
+* Callback for updating note services.
+*
+* @param int $id
+* @param object $data
+* @return object
+*/
+function _blast_ui_update($id, $data) {
+  return services_error('Missing _blast_ui_update', 406);
+} 
+/**
+* Callback for retrieving note services.
+*
+* @param int $id
+* @return object
+*/
+function _blast_ui_retrieve($id) {
+ return services_error('Missing _blast_ui_retrieve', 406);
+}
+
+/**
+* Callback for deleting note services.
+*
+* @param int $id
+* @return object
+*/
+function _blast_ui_delete($id) {
+  return services_error('Missing _blast_ui_delete', 406);
+}
+
+function _blast_ui_index($page, $parameters) {
+ return array(
+      'Nucleotide' => array ( 
+        'Nucleotide' => 'blastn',
+      	'protein' => 'blastx',
+      ),
+      'Protein' => array ( 
+        'Nucleotide' => 'tblastn',
+      	'protein' => 'blastp',
+      ),
+    ); 
+  
+//  return services_error('Missing _blast_ui_index solved', 406);
+}
+
+function _blast_ui_getDatabaseType() {
+
+    return array(
+      'Nucleotide' => array ( 
+        'Nucleotide' => 'blastn',
+      	'protein' => 'blastx',
+      ),
+      'Protein' => array ( 
+        'Nucleotide' => 'tblastn',
+      	'protein' => 'blastp',
+      ),
+    ); 
+}
+
+
+function _blast_ui_getDatabaseOption() {
+
+ $db_type = 'nucleotide';
+ $options = get_blast_database_options($db_type);
+return $options;
+}
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+
+

+ 56 - 71
theme/blast_align_image.php

@@ -17,22 +17,10 @@
  * history:
  * history:
  *    09/23/10  Carson  created
  *    09/23/10  Carson  created
  *    04/16/12  eksc    adapted into POPcorn code
  *    04/16/12  eksc    adapted into POPcorn code
- *		03/12/15	deepak	Adapted code into Tripal BLAST
+ *    03/12/15  deepak  Adapted code into Tripal BLAST
  */
  */
  
  
-  /* include_once('../../inc/lib.php');
-   session_start();
-   $pc_system = getSystemInfoPC('sequence_search');
-  
-   $acc    = getCGIParamPC('acc',    'GP', '');
-   $scores = getCGIParamPC('scores', 'GP', '');
-   $links  = getCGIParamPC('links',  'GP', '');
-   $hits   = getCGIParamPC('hits',   'GP', '');
-   $tsize  = intval(getCGIParamPC('tsize', 'GP', ''));
-   $qsize  = intval(getCGIParamPC('qsize', 'GP', ''));
-   $name  = getCGIParamPC('name',    'GP', '');
-  */
-   // extract hit information from hit param
+// extract hit information from hit param
 function generateImage($acc = '', $scores, $hits, $tsize, $qsize, $name, $hit_name) {
 function generateImage($acc = '', $scores, $hits, $tsize, $qsize, $name, $hit_name) {
    $tok = strtok($hits, ";");
    $tok = strtok($hits, ";");
    $b_hits = Array();
    $b_hits = Array();
@@ -118,77 +106,77 @@ function generateImage($acc = '', $scores, $hits, $tsize, $qsize, $name, $hit_na
    // Draw solids for HSP alignments
    // Draw solids for HSP alignments
    for ($ii=count($b_hits)-1; $ii>=0; $ii--) {
    for ($ii=count($b_hits)-1; $ii>=0; $ii--) {
       // alignment 
       // alignment 
-	
-   	$cur_hit = $b_hits[$ii];
-   	$cur_score = intval($b_scores[$ii]);
-   	
-   	// set color according to score
-   	$cur_color = $darkgray;
-   	if ($cur_score > 200) { 
-   		$cur_color = $strong;
-   	} 
-   	else if ($cur_score > 80 && $cur_score <= 200) { 
-   		$cur_color = $moderate;
-   	} 
-   	else if ($cur_score > 50 && $cur_score <= 80) { 
-   		$cur_color = $present;
-   	} 
-   	else if ($cur_score > 40 && $cur_score <= 50) { 
-   		$cur_color = $weak;
-   	} 
-	
-	   $t_start = $tnormal *  intval(strtok($cur_hit, "_")) + $t_xstart;
+  
+     $cur_hit = $b_hits[$ii];
+     $cur_score = intval($b_scores[$ii]);
+     
+     // set color according to score
+     $cur_color = $darkgray;
+     if ($cur_score > 200) { 
+       $cur_color = $strong;
+     } 
+     else if ($cur_score > 80 && $cur_score <= 200) { 
+       $cur_color = $moderate;
+     } 
+     else if ($cur_score > 50 && $cur_score <= 80) { 
+       $cur_color = $present;
+     } 
+     else if ($cur_score > 40 && $cur_score <= 50) { 
+       $cur_color = $weak;
+     } 
+  
+     $t_start = $tnormal *  intval(strtok($cur_hit, "_")) + $t_xstart;
       $t_end = $tnormal *  intval(strtok("_")) + $t_xstart;
       $t_end = $tnormal *  intval(strtok("_")) + $t_xstart;
       $q_start = $qnormal * intval(strtok("_")) + $q_xstart;
       $q_start = $qnormal * intval(strtok("_")) + $q_xstart;
       $q_end = $qnormal *  intval(strtok("_")) + $q_xstart;
       $q_end = $qnormal *  intval(strtok("_")) + $q_xstart;
-		
+    
       $hit1_array = array($t_start, $t_yend, $t_end, $t_yend, $q_end, 
       $hit1_array = array($t_start, $t_yend, $t_end, $t_yend, $q_end, 
                           $q_ystart, $q_start, $q_ystart);
                           $q_ystart, $q_start, $q_ystart);
 
 
-	   // HSP coords
+     // HSP coords
       imagefilledpolygon($img, $hit1_array, 4, $cur_color);
       imagefilledpolygon($img, $hit1_array, 4, $cur_color);
-	
+  
    }//each hit
    }//each hit
 
 
    // Draw lines over fills for HSP alignments
    // Draw lines over fills for HSP alignments
    for ($ii=0; $ii<count($b_hits); $ii++) {
    for ($ii=0; $ii<count($b_hits); $ii++) {
-   	// alignment 
-   	
-   	$cur_hit = $b_hits[$ii];
-   	$t_start = $tnormal *  intval(strtok($cur_hit, "_")) + $t_xstart;
+     // alignment 
+     
+     $cur_hit = $b_hits[$ii];
+     $t_start = $tnormal *  intval(strtok($cur_hit, "_")) + $t_xstart;
       $t_end = $tnormal *  intval(strtok("_")) + $t_xstart;
       $t_end = $tnormal *  intval(strtok("_")) + $t_xstart;
       $q_start = $qnormal * intval(strtok("_")) + $q_xstart;
       $q_start = $qnormal * intval(strtok("_")) + $q_xstart;
       $q_end = $qnormal *  intval(strtok("_")) + $q_xstart;
       $q_end = $qnormal *  intval(strtok("_")) + $q_xstart;
-   		
-   	$hit1_array = array($t_start, $t_yend, $t_end, $t_yend, $q_end, $q_ystart,
-   	                    $q_start, $q_ystart,);
+       
+     $hit1_array = array($t_start, $t_yend, $t_end, $t_yend, $q_end, $q_ystart,
+                         $q_start, $q_ystart,);
    
    
-   	imagerectangle($img, $t_start, $t_ystart, $t_end, $t_yend, $black);
-   	imagerectangle($img, $q_start, $q_ystart, $q_end, $q_yend, $black);
-   	imagepolygon ($img, $hit1_array, 4, $black);
+     imagerectangle($img, $t_start, $t_ystart, $t_end, $t_yend, $black);
+     imagerectangle($img, $q_start, $q_ystart, $q_end, $q_yend, $black);
+     imagepolygon ($img, $hit1_array, 4, $black);
 
 
       // show HSP
       // show HSP
       
       
- 		imagestring($img, 3, 2, $hsp_bary, ($acc ."HSP" . ($ii + 1)), $black);
+     imagestring($img, 3, 2, $hsp_bary, ($acc ."HSP" . ($ii + 1)), $black);
 
 
-   	$cur_score = intval($b_scores[$ii]);
-   	
-   	// set color according to score
-   	$cur_color = $darkgray;
-   	if ($cur_score > 200) { 
-   		$cur_color = $strong;
-   	} 
-   	else if ($cur_score > 80 && $cur_score <= 200) { 
-   		$cur_color = $moderate;
-   	} 
-   	else if ($cur_score > 50 && $cur_score <= 80) { 
-   		$cur_color = $present;
-   	} 
-   	else if ($cur_score > 40 && $cur_score <= 50) { 
-   		$cur_color = $weak;
-   	}
-   	
-   	imagefilledrectangle($img, $q_start, $hsp_bary, $q_end, $hsp_bary+10, $cur_color);
+     $cur_score = intval($b_scores[$ii]);
+     
+     // set color according to score
+     $cur_color = $darkgray;
+     if ($cur_score > 200) { 
+       $cur_color = $strong;
+     } 
+     else if ($cur_score > 80 && $cur_score <= 200) { 
+       $cur_color = $moderate;
+     } 
+     else if ($cur_score > 50 && $cur_score <= 80) { 
+       $cur_color = $present;
+     } 
+     else if ($cur_score > 40 && $cur_score <= 50) { 
+       $cur_color = $weak;
+     }
+     
+     imagefilledrectangle($img, $q_start, $hsp_bary, $q_end, $hsp_bary+10, $cur_color);
       $hsp_bary += 15;
       $hsp_bary += 15;
    }//each hit
    }//each hit
 
 
@@ -215,9 +203,6 @@ function generateImage($acc = '', $scores, $hits, $tsize, $qsize, $name, $hit_na
    imagefilledRectangle($img, $xchart, $ychart + ($yinc * 4) + $xinc, $xchart + $yinc, $ychart + ($yinc * 5), $weak);
    imagefilledRectangle($img, $xchart, $ychart + ($yinc * 4) + $xinc, $xchart + $yinc, $ychart + ($yinc * 5), $weak);
    imagefilledRectangle($img, $xchart, $ychart + ($yinc * 5) + $xinc, $xchart + $yinc, $ychart + ($yinc * 6), $darkgray);
    imagefilledRectangle($img, $xchart, $ychart + ($yinc * 5) + $xinc, $xchart + $yinc, $ychart + ($yinc * 6), $darkgray);
    
    
-	 return $img;
-  // write out images
-//    header("Content-type: image/png");
-//    imagepng($img);
+   return $img;
 }
 }
-?>
+?>

+ 5 - 5
theme/blast_nucleotide_user_menupage.tpl.php

@@ -35,25 +35,25 @@ local alignment search tool. J. Mol. Biol., 215, 403–410.</blockquote>
     <th>BLAST Program</th>
     <th>BLAST Program</th>
   </tr>
   </tr>
   <tr class= "blast-highlighted">
   <tr class= "blast-highlighted">
-    <td rowspan="2">Nucleotide</td>
     <td>Nucleotide</td>
     <td>Nucleotide</td>
-    <td><?php print l('blastn', 'blast/nucleotide/nucleotide');?>:
+    <td rowspan="2">Nucleotide</td>
+    <td><?php print l('blastn', './blast/nucleotide/nucleotide');?>:
       Search a nucleotide database using a nucleotide query.</td>
       Search a nucleotide database using a nucleotide query.</td>
   </tr>
   </tr>
   <tr class="blast-highlighted">
   <tr class="blast-highlighted">
     <td>Protein</td>
     <td>Protein</td>
-    <td><?php print l('blastx', 'blast/nucleotide/protein');?>:
+    <td><?php print l('blastx', './blast/nucleotide/protein');?>:
       Search protein database using a translated nucleotide query.</td>
       Search protein database using a translated nucleotide query.</td>
   </tr>
   </tr>
   <tr>
   <tr>
     <td  rowspan="2">Protein</td>
     <td  rowspan="2">Protein</td>
     <td>Nucleotide</td>
     <td>Nucleotide</td>
-    <td><?php print l('tblastn', 'blast/protein/nucleotide');?>:
+    <td><?php print l('tblastn', './blast/protein/nucleotide');?>:
       Search translated nucleotide database using a protein query.</td>
       Search translated nucleotide database using a protein query.</td>
   </tr>
   </tr>
   <tr>
   <tr>
     <td>Protein</td>
     <td>Protein</td>
-    <td><?php print l('blastp', 'blast/protein/protein');?>:
+    <td><?php print l('blastp', './blast/protein/protein');?>:
       Search protein database using a protein query.</td>
       Search protein database using a protein query.</td>
   </tr>
   </tr>
 </table>
 </table>

+ 4 - 5
theme/blast_protein_user_menupage.tpl.php

@@ -4,7 +4,6 @@
  * @file
  * @file
  *
  *
  */
  */
-
 ?>
 ?>
 
 
 <style>
 <style>
@@ -37,23 +36,23 @@ local alignment search tool. J. Mol. Biol., 215, 403–410.</blockquote>
   <tr>
   <tr>
     <td rowspan="2">Nucleotide</td>
     <td rowspan="2">Nucleotide</td>
     <td>Nucleotide</td>
     <td>Nucleotide</td>
-    <td><?php print l('blastn', 'blast/nucleotide/nucleotide');?>:
+    <td><?php print l('blastn', './blast/nucleotide/nucleotide');?>:
       Search a nucleotide database using a nucleotide query.</td>
       Search a nucleotide database using a nucleotide query.</td>
   </tr>
   </tr>
   <tr>
   <tr>
     <td>Protein</td>
     <td>Protein</td>
-    <td><?php print l('blastx', 'blast/nucleotide/protein');?>:
+    <td><?php print l('blastx', './blast/nucleotide/protein');?>:
       Search protein database using a translated nucleotide query.</td>
       Search protein database using a translated nucleotide query.</td>
   </tr>
   </tr>
   <tr class="blast-highlighted">
   <tr class="blast-highlighted">
     <td  rowspan="2">Protein</td>
     <td  rowspan="2">Protein</td>
     <td>Nucleotide</td>
     <td>Nucleotide</td>
-    <td><?php print l('tblastn', 'blast/protein/nucleotide');?>:
+    <td><?php print l('tblastn', './blast/protein/nucleotide');?>:
       Search translated nucleotide database using a protein query.</td>
       Search translated nucleotide database using a protein query.</td>
   </tr>
   </tr>
   <tr class="blast-highlighted">
   <tr class="blast-highlighted">
     <td>Protein</td>
     <td>Protein</td>
-    <td><?php print l('blastp', 'blast/protein/protein');?>:
+    <td><?php print l('blastp', './blast/protein/protein');?>:
       Search protein database using a protein query.</td>
       Search protein database using a protein query.</td>
   </tr>
   </tr>
 </table>
 </table>

+ 192 - 159
theme/blast_report.tpl.php

@@ -5,28 +5,29 @@
  *
  *
  * Variables Available in this template:
  * Variables Available in this template:
  *   $xml_filename: The full path & filename of XML file containing the BLAST results
  *   $xml_filename: The full path & filename of XML file containing the BLAST results
- *		@deepaksomanadh: $job_data = meta data related to the current job
+ *    @deepaksomanadh: $job_data = meta data related to the current job
  */
  */
+ 
+// uncomment this to see the contents of the $blastdb object
+//echo "blastdb:<pre>";var_dump($blastdb);echo "</pre>";
 
 
 // Set ourselves up to do link-out if our blast database is configured to do so.
 // Set ourselves up to do link-out if our blast database is configured to do so.
 $linkout = FALSE;
 $linkout = FALSE;
+
 if ($blastdb->linkout->none === FALSE) {
 if ($blastdb->linkout->none === FALSE) {
-  $linkout = TRUE;
+  $linkout_type  = $blastdb->linkout->type;
   $linkout_regex = $blastdb->linkout->regex;
   $linkout_regex = $blastdb->linkout->regex;
-  if (isset($blastdb->linkout->db_id->urlprefix) AND !empty($blastdb->linkout->db_id->urlprefix)) {
+  
+  // Note that URL prefix is not required if linkout type is 'custom'
+  if (isset($blastdb->linkout->db_id->urlprefix) && !empty($blastdb->linkout->db_id->urlprefix)) {
     $linkout_urlprefix = $blastdb->linkout->db_id->urlprefix;
     $linkout_urlprefix = $blastdb->linkout->db_id->urlprefix;
-
-    // Furthermore, check that we can determine the URL.
-    // (ie: that the function specified to do so, exists).
-    if (function_exists($blastdb->linkout->url_function)) {
-      $url_function = $blastdb->linkout->url_function;
-    }
-    else {
-      $linkout = FALSE;
-    }
   }
   }
-  else {
-    $linkout = FALSE;
+
+  // Check that we can determine the linkout URL.
+  // (ie: that the function specified to do so, exists).
+  if (function_exists($blastdb->linkout->url_function)) {
+    $url_function = $blastdb->linkout->url_function;
+    $linkout = TRUE;
   }
   }
 }
 }
 
 
@@ -40,8 +41,15 @@ $no_hits = TRUE;
 
 
 ?>
 ?>
 
 
-<!-- JQuery controlling display of the alignment information (hidden by default) -->
 <script type="text/javascript">
 <script type="text/javascript">
+  window.onload = function() {
+    if (!window.location.hash) {
+      window.location = window.location + '#loaded';
+      window.location.reload();
+    }
+  }
+
+  // JQuery controlling display of the alignment information (hidden by default)
   $(document).ready(function(){
   $(document).ready(function(){
 
 
     // Hide the alignment rows in the table
     // Hide the alignment rows in the table
@@ -67,49 +75,46 @@ $no_hits = TRUE;
 </style>
 </style>
 
 
 <p><strong>Download</strong>:
 <p><strong>Download</strong>:
-  <a href="<?php print '../../' . $html_filename; ?>">HTML</a>,
+  <a href="<?php print '../../' . $html_filename; ?>">Alignment</a>,
   <a href="<?php print '../../' . $tsv_filename; ?>">Tab-Delimited</a>,
   <a href="<?php print '../../' . $tsv_filename; ?>">Tab-Delimited</a>,
   <a href="<?php print '../../' . $xml_filename; ?>">XML</a>
   <a href="<?php print '../../' . $xml_filename; ?>">XML</a>
 </p>
 </p>
-<!--	@deepaksomanadh: For displaying BLAST command details -->
+
+<!--  @deepaksomanadh: For displaying BLAST command details -->
 <table>
 <table>
 <tr>
 <tr>
-	<th>Input query sequence(s) </th>
-	<th>Target Database selected </th>
-	<th>BLAST command executed </th>
+  <th>Input query sequence(s) </th>
+  <th>Target Database selected </th>
+  <th>BLAST command executed </th>
 <tr>
 <tr>
 <tr>
 <tr>
 <?php 
 <?php 
-	// get input sequences from job_data variable
-
-	$query_def = $job_id_data['query_def'];
-	echo "<td>";
-	echo "<ol>";
-	foreach($query_def as $row) {
-		echo "<li>";		
-		echo  $row . "</li>";
-	}
-	echo "</ol></td>";
-	echo "<td>" . 	$job_id_data['db_name'] . "</td>"
- ?> 
-
-
-<?php
-	include_once("blast_align_image.php");
+  // get input sequences from job_data variable
+  $query_def = $job_id_data['query_def'];
+  echo "<td>";
+  echo "<ol>";
+  foreach($query_def as $row) {
+    echo "<li>";    
+    echo  $row . "</li>";
+  }
+  echo "</ol></td>";
+  echo "<td>" .   $job_id_data['db_name'] . "</td>";
+ 
+  include_once("blast_align_image.php");
  
  
-	//display the BLAST command without revealing the internal path
-	$blast_cmd = $job_id_data['program'];
-	
-	foreach($job_id_data['options'] as $key => $value) {
-			$blast_cmd .= ' -' . $key. ' ' . $value ;
-	}
-	print "<td>" . $blast_cmd . "</td>";	
+  //display the BLAST command without revealing the internal path
+  $blast_cmd = $job_id_data['program'];
+  
+  foreach($job_id_data['options'] as $key => $value) {
+      $blast_cmd .= ' -' . $key. ' ' . $value ;
+  }
+  print "<td>" . $blast_cmd . "</td>";  
  ?>
  ?>
 </table>
 </table>
 
 
 <p>The following table summarizes the results of your BLAST. 
 <p>The following table summarizes the results of your BLAST. 
 Click on a <strong>triangle </strong> on the left to see the alignment and a visualization of the hit, 
 Click on a <strong>triangle </strong> on the left to see the alignment and a visualization of the hit, 
-and click the <strong>target name </strong> to open a new window with a genome browser around this hit.</p>
+and click the <strong>target name </strong> to get more information about the target hit.</p>
 
 
 <?php
 <?php
 include_once("blast_align_image.php");
 include_once("blast_align_image.php");
@@ -124,7 +129,7 @@ $xml = simplexml_load_file($xml_filename);
 if ($xml) {
 if ($xml) {
   // Specify the header of the table
   // Specify the header of the table
   $header = array(
   $header = array(
-		'arrow-col' =>  array('data' => '', 'class' => array('arrow-col')),
+    'arrow-col' =>  array('data' => '', 'class' => array('arrow-col')),
     'number' =>  array('data' => '#', 'class' => array('number')),
     'number' =>  array('data' => '#', 'class' => array('number')),
     'query' =>  array('data' => 'Query Name  (Click for alignment & visualization)', 'class' => array('query')),
     'query' =>  array('data' => 'Query Name  (Click for alignment & visualization)', 'class' => array('query')),
     'hit' =>  array('data' => 'Target Name', 'class' => array('hit')),
     'hit' =>  array('data' => 'Target Name', 'class' => array('hit')),
@@ -137,110 +142,150 @@ if ($xml) {
   // Parse the BLAST XML to generate the rows of the table
   // Parse the BLAST XML to generate the rows of the table
   // where each hit results in two rows in the table: 1) A summary of the query/hit and
   // where each hit results in two rows in the table: 1) A summary of the query/hit and
   // significance and 2) additional information including the alignment
   // significance and 2) additional information including the alignment
-  foreach($xml->{'BlastOutput_iterations'}->children() as $iteration) {
+  foreach ($xml->{'BlastOutput_iterations'}->children() as $iteration) {
     $children_count = $iteration->{'Iteration_hits'}->children()->count();
     $children_count = $iteration->{'Iteration_hits'}->children()->count();
-		//@deepaksomanadh: Code added for BLAST visualization
-		// parameters that need to be passed for BLAST image generation
-		$target_name = '';
-		$q_name = $xml->{'BlastOutput_query-def'};
-		$query_size = $xml->{'BlastOutput_query-len'};
-		$target_size = $iteration->{'Iteration_stat'}->{'Statistics'}->{'Statistics_db-len'};
-		
-    if($children_count != 0) {
-      foreach($iteration->{'Iteration_hits'}->children() as $hit) {
+    //@deepaksomanadh: Code added for BLAST visualization
+    // parameters that need to be passed for BLAST image generation
+    $target_name = '';
+    $q_name = $xml->{'BlastOutput_query-def'};
+    $query_size = $xml->{'BlastOutput_query-len'};
+    $target_size = $iteration->{'Iteration_stat'}->{'Statistics'}->{'Statistics_db-len'};
+    
+    if ($children_count != 0) {
+      foreach ($iteration->{'Iteration_hits'}->children() as $hit) {
         if (is_object($hit)) {
         if (is_object($hit)) {
           $count +=1;
           $count +=1;
           $zebra_class = ($count % 2 == 0) ? 'even' : 'odd';
           $zebra_class = ($count % 2 == 0) ? 'even' : 'odd';
           $no_hits = FALSE;
           $no_hits = FALSE;
 
 
-					// RETRIEVE INFO
-          $hit_name = (preg_match('/BL_ORD_ID/', $hit->{'Hit_id'})) ? $hit->{'Hit_def'} : $hit->{'Hit_id'};	
-					$score = $hit->{'Hit_hsps'}->{'Hsp'}->{'Hsp_score'};
-					$evalue = $hit->{'Hit_hsps'}->{'Hsp'}->{'Hsp_evalue'};
-				  $query_name = $iteration->{'Iteration_query-def'};
-
-					// Round e-val to two decimal values
-					$rounded_evalue = '';
-					if (strpos($evalue,'e') != false) {
-					 $evalue_split = explode('e', $evalue);
-					 $rounded_evalue = round($evalue_split[0], 2, PHP_ROUND_HALF_EVEN);				    
-						 $rounded_evalue .= 'e' . $evalue_split[1];
-					}
-					else { 
-							$rounded_evalue = $evalue;
-					}				
-				
-				  // ALIGNMENT ROW (collapsed by default)
-					// Process HSPs
-					// @deepaksomanadh: Code added for BLAST visualization
-					// hit array and corresponding bit scores 
-					// hits=4263001_4262263_1_742;4260037_4259524_895_1411;&scores=722;473;
-					$HSPs = array();
-					$hit_hsps = '';
-					$hit_hsp_score = '';
-					$target_size = $hit->{'Hit_len'};
-		
-					foreach ($hit->{'Hit_hsps'}->children() as $hsp_xml) {
-						$HSPs[] = (array) $hsp_xml;
-		
-						$hit_hsps .=  $hsp_xml->{'Hsp_hit-from'} . '_' . $hsp_xml->{'Hsp_hit-to'}  
-														. '_' . $hsp_xml->{'Hsp_query-from'} . '_'
-														. $hsp_xml->{'Hsp_query-to'} . ';';	
-						$Hsp_bit_score .= 	$hsp_xml->{'Hsp_bit-score'} .';';							
-
-					}	 
-					// SUMMARY ROW
-					// If the id is of the form gnl|BL_ORD_ID|### then the parseids flag
-					// to makeblastdb did a really poor job. In this case we want to use
-					// the def to provide the original FASTA header.
-					
+          // RETRIEVE INFO
+          $hit_name = (preg_match('/BL_ORD_ID/', $hit->{'Hit_id'})) ? $hit->{'Hit_def'} : $hit->{'Hit_id'};  
+          $score = $hit->{'Hit_hsps'}->{'Hsp'}->{'Hsp_score'};
+          $evalue = $hit->{'Hit_hsps'}->{'Hsp'}->{'Hsp_evalue'};
+          $query_name = $iteration->{'Iteration_query-def'};
+
+          // Round e-val to two decimal values
+          $rounded_evalue = '';
+          if (strpos($evalue,'e') != false) {
+            $evalue_split = explode('e', $evalue);
+            $rounded_evalue = round($evalue_split[0], 2, PHP_ROUND_HALF_EVEN);            
+            $rounded_evalue .= 'e' . $evalue_split[1];
+          }
+          else { 
+            $rounded_evalue = $evalue;
+          }        
+        
+          // ALIGNMENT ROW (collapsed by default)
+          // Process HSPs
+          // @deepaksomanadh: Code added for BLAST visualization
+          // hit array and corresponding bit scores 
+          // hits=4263001_4262263_1_742;4260037_4259524_895_1411;&scores=722;473;
+          $HSPs = array();
+          $track_start = INF;
+          $track_end = -1;
+          $hsps_range = '';
+          $hit_hsps = '';
+          $hit_hsp_score = '';
+          $target_size = $hit->{'Hit_len'};
+    
+          foreach ($hit->{'Hit_hsps'}->children() as $hsp_xml) {
+            $HSPs[] = (array) $hsp_xml;
+    
+            if ($track_start > $hsp_xml->{'Hsp_hit-from'}) {
+              $track_start = $hsp_xml->{'Hsp_hit-from'} . "";
+            }
+            if ($track_end < $hsp_xml->{'Hsp_hit-to'}) {
+              $track_end = $hsp_xml->{'Hsp_hit-to'} . "";
+            }
+          }  
+          $range_start = (int) $track_start - 50000;
+          $range_end = (int) $track_end + 50000;
+        
+          if ($range_start < 1) 
+            $range_start = 1;  
+
+          // For BLAST visualization 
+          $target_size = $hit->{'Hit_len'};
+        
+          foreach ($hit->{'Hit_hsps'}->children() as $hsp_xml) {
+            $hit_hsps .=  $hsp_xml->{'Hsp_hit-from'} . '_' . 
+                          $hsp_xml->{'Hsp_hit-to'} . '_' . 
+                          $hsp_xml->{'Hsp_query-from'} . '_' . $hsp_xml->{'Hsp_query-to'} . 
+                          ';';  
+            $Hsp_bit_score .=   $hsp_xml->{'Hsp_bit-score'} .';';              
+          }      
+          
+          // SUMMARY ROW
+          // If the id is of the form gnl|BL_ORD_ID|### then the parseids flag
+          // to makeblastdb did a really poor job. In this case we want to use
+          // the def to provide the original FASTA header.
+          
           // If our BLAST DB is configured to handle link-outs then use the
           // If our BLAST DB is configured to handle link-outs then use the
           // regex & URL prefix provided to create one.
           // regex & URL prefix provided to create one.
+          $hit_name = $hit->{'Hit_def'};
+          $query_name = $iteration->{'Iteration_query-def'};
+ 
           if ($linkout) {
           if ($linkout) {
+//echo "link out regex: $linkout_regex executed on [$hit_name]<br>";
+//preg_match($linkout_regex, $hit_name, $linkout_match);
+//echo "<br>matches:<pre>" . var_dump($linkout_match);echo "</pre>";
             if (preg_match($linkout_regex, $hit_name, $linkout_match)) {
             if (preg_match($linkout_regex, $hit_name, $linkout_match)) {
-
               $linkout_id = $linkout_match[1];
               $linkout_id = $linkout_match[1];
               $hit->{'linkout_id'} = $linkout_id;
               $hit->{'linkout_id'} = $linkout_id;
               $hit->{'hit_name'} = $hit_name;
               $hit->{'hit_name'} = $hit_name;
-
-              $hit_url = call_user_func(
-                $url_function,
-                $linkout_urlprefix,
-                $hit,
-                array(
-                  'query_name' => $query_name,
-                  'score' => $score,
-                  'e-value' => $evalue,
-                  'HSPs' => $HSPs
-                )
-              );
-
-              if ($hit_url) {
-                $hit_name = l(
-                  $linkout_id,
-                  $hit_url,
-                  array('attributes' => array('target' => '_blank'))
-                );
-              }
             }
             }
-          }
+            
+            $hit_url = call_user_func(
+              $url_function,
+              $linkout_urlprefix,
+              $hit,
+              array(
+                'query_name' => $query_name,
+                'score'      => $score,
+                'e-value'    => $evalue,
+                'HSPs'       => $HSPs,
+                'Target'     => $blastdb->title,
+              )
+            );
+            
+            // The linkout id might have been set/changed by the custom linkout code.
+            if ($linkout_type == 'custom' && $hit->{'linkout_id'}) {
+              $linkout_id = $hit->{'linkout_id'};
+            }
+
 
 
-					//@deepaksomanadh: Code added for BLAST visualization
-					// get the image and display
-				  $hit_img = generateImage($target_name, $Hsp_bit_score, $hit_hsps, $target_size, $query_size, $q_name, $hit_name);
-				
-					ob_start(); // Start buffering the output
-					imagepng($hit_img, null, 0, PNG_NO_FILTER);
-					$b64 = base64_encode(ob_get_contents()); // Get what we've just outputted and base64 it
-					imagedestroy($hit_img);
-					ob_end_clean();
-
-					// Print the HTML tag with the image embedded
-					$hit_img = '<h4><strong> Hit Visualization </strong></h4> <br><img src="data:image/png;base64,'.$b64.'"/>';
-					
+            if ($hit_url) {
+/* eksc- l() URL-encodes the URL path too, which is often not what we want.
+                  $hit_name = l(
+                    $linkout_id,
+                    $hit_url,
+                    array('attributes' => array('target' => '_blank'))
+                  );
+*/
+               $hit_name = "
+                  <a href=\"$hit_url\" target=\"_blank\">
+                    $linkout_id
+                  </a>";
+            }
+          }//handle linkout
+
+          //@deepaksomanadh: Code added for BLAST visualization
+          // get the image and display
+          $hit_img = generateImage($target_name, $Hsp_bit_score, $hit_hsps, 
+                                   $target_size, $query_size, $q_name, $hit_name);
+        
+          ob_start(); // Start buffering the output
+          imagepng($hit_img, null, 0, PNG_NO_FILTER);
+          $b64 = base64_encode(ob_get_contents()); // Get what we've just outputted and base64 it
+          imagedestroy($hit_img);
+          ob_end_clean();
+  
+          // Print the HTML tag with the image embedded
+          $hit_img = '<h4><strong> Hit Visualization </strong></h4> <br><img src="data:image/png;base64,'.$b64.'"/>';
+          
           $row = array(
           $row = array(
             'data' => array(
             'data' => array(
-							'arrow-col' => array('data' => '<div class="arrow"></div>', 'class' => array('arrow-col')),
+              'arrow-col' => array('data' => '<div class="arrow"></div>', 'class' => array('arrow-col')),
               'number' => array('data' => $count, 'class' => array('number')),
               'number' => array('data' => $count, 'class' => array('number')),
               'query' => array('data' => $query_name, 'class' => array('query')),
               'query' => array('data' => $query_name, 'class' => array('query')),
               'hit' => array('data' => $hit_name, 'class' => array('hit')),
               'hit' => array('data' => $hit_name, 'class' => array('hit')),
@@ -256,13 +301,13 @@ if ($xml) {
 
 
           $row = array(
           $row = array(
             'data' => array(
             'data' => array(
-							'arrow' => '',
+              'arrow' => '',
               'number' => '',
               'number' => '',
               'query' => array(
               'query' => array(
                 'data' => theme('blast_report_alignment_row', array('HSPs' => $HSPs)),
                 'data' => theme('blast_report_alignment_row', array('HSPs' => $HSPs)),
               //  'colspan' => 4,
               //  'colspan' => 4,
               ),
               ),
-							'hit' => array(
+              'hit' => array(
                 'data' => $hit_img,
                 'data' => $hit_img,
                 'colspan' => 3,
                 'colspan' => 3,
               ),
               ),
@@ -272,17 +317,17 @@ if ($xml) {
           );
           );
           $rows[] = $row;
           $rows[] = $row;
 
 
-        }// end of if - checks $hit
-      } //end of foreach - iteration_hits
-    }	// end of if - check for iteration_hits
+        }//end of if - checks $hit
+      }//end of foreach - iteration_hits
+    }//end of if - check for iteration_hits
+    
     else {
     else {
-
       // Currently where the "no results" is added.
       // Currently where the "no results" is added.
       $query_name = $iteration->{'Iteration_query-def'};
       $query_name = $iteration->{'Iteration_query-def'};
       $query_with_no_hits[] = $query_name;
       $query_with_no_hits[] = $query_name;
 
 
-		} // end of else
-  }	//end of foreach - BlastOutput_iterations
+    }//no results
+  }//end of foreach - BlastOutput_iterations
 
 
   if ($no_hits) {
   if ($no_hits) {
     print '<p class="no-hits-message">No results found.</p>';
     print '<p class="no-hits-message">No results found.</p>';
@@ -303,28 +348,16 @@ if ($xml) {
         'attributes' => array('id' => 'blast_report'),
         'attributes' => array('id' => 'blast_report'),
       ));
       ));
     }
     }
-  }
-}
+  }//handle no hits
+}//XML exists
+
 else {
 else {
   drupal_set_title('BLAST: Error Encountered');
   drupal_set_title('BLAST: Error Encountered');
   print '<p>We encountered an error and are unable to load your BLAST results.</p>';
   print '<p>We encountered an error and are unable to load your BLAST results.</p>';
 }
 }
 ?>
 ?>
-<p> <!--	@deepaksomanadh: Building the edit and resubmit URL --> 
-	 <a style ="align:center" href="<?php print '../../'. $job_id_data['job_url'] . '?jid=' . base64_encode($job_id) ?>">Edit this query and re-submit</a>	
+
+<p> 
+  <a style ="align:center" href="<?php print '../../'. $job_id_data['job_url'] . '?jid=' . base64_encode($job_id) ?>">Edit this query and re-submit</a>  
 </p>
 </p>
-<strong> Recent Jobs </strong>
-	<ol>
-	<?php
-			$sid = session_id();	
-			$jobs = $_SESSION['all_jobs'][$sid];
-	
-			foreach ( $jobs as $job) {
-				echo "<li>";
-				$q_def = !isset($job['query_defs'][0]) ? "Query" : $job['query_defs'][0];
-				echo "<a href='" . "../../" . $job['job_output_url'] ."' >"  
-								. $q_def ."->". $job['program'] . "</a>";
-				echo "</li>";
-			}
-	?>
-	</ol>
+<?php echo get_recent_jobs(); ?>

+ 30 - 28
theme/blast_report_alignment_row.tpl.php

@@ -47,32 +47,34 @@
         // Determine the current coordinates.
         // Determine the current coordinates.
         $coord['qstart'] = $hsp['Hsp_query-from'] + ($k * 60);
         $coord['qstart'] = $hsp['Hsp_query-from'] + ($k * 60);
         $coord['qstart'] = ($k == 0) ? $coord['qstart'] : $coord['qstart'];
         $coord['qstart'] = ($k == 0) ? $coord['qstart'] : $coord['qstart'];
-				// code added to fix the range issue
-				// Cordinates can increase or decrease
-				if($hsp['Hsp_hit-from'] < $hsp['Hsp_hit-to']) {
-							$coord['hstart'] = $hsp['Hsp_hit-from'] + ($k * 60);		
-					}
-					else {
-									$coord['hstart'] = $hsp['Hsp_hit-from'] - ($k * 60);
-						}
-					$coord['qstop'] = $hsp['Hsp_query-from'] + (($k + 1) * 60) - 1;
-					$coord['qstop'] = ($coord['qstop'] > $hsp['Hsp_query-to']) ? $hsp['Hsp_query-to'] : $coord['qstop'];
-			
-					if($hsp['Hsp_hit-from'] < $hsp['Hsp_hit-to']) {
-							$coord['hstop'] = $hsp['Hsp_hit-from'] + (($k + 1) * 60) - 1;
-							$coord['hstop'] = ($coord['hstop'] > $hsp['Hsp_hit-to']) ? $hsp['Hsp_hit-to'] : $coord['hstop'];
-					
-					}
-					else {
-								$coord['hstop'] = $hsp['Hsp_hit-from'] - (($k + 1) * 60) + 1;
-								$coord['hstop'] = ($coord['hstop'] < $hsp['Hsp_hit-to']) ? $hsp['Hsp_hit-to'] : $coord['hstop'];
-					}
-					// Pad these coordinates to ensure columned display.
-					foreach ($coord as $ck => $val) {
-						$pad_type = (preg_match('/start/', $ck)) ? STR_PAD_LEFT : STR_PAD_RIGHT;
-						$coord[$ck] = str_pad($val, $coord_length, '#', $pad_type);
-						$coord[$ck] =	str_replace('#', '&nbsp', $coord[$ck]);
-	        }
+        
+        // code added to fix the range issue
+        // Cordinates can increase or decrease
+        if($hsp['Hsp_hit-from'] < $hsp['Hsp_hit-to']) {
+            $coord['hstart'] = $hsp['Hsp_hit-from'] + ($k * 60);    
+          }
+          else {
+            $coord['hstart'] = $hsp['Hsp_hit-from'] - ($k * 60);
+          }
+//          $coord['qstop'] = $hsp['Hsp_query-from'] + (($k + 1) * 60) - 1;
+//          $coord['qstop'] = ($coord['qstop'] > $hsp['Hsp_query-to']) ? $hsp['Hsp_query-to'] : $coord['qstop'];
+      
+          if ($hsp['Hsp_hit-from'] < $hsp['Hsp_hit-to']) {
+            $coord['hstop'] = $hsp['Hsp_hit-from'] + (($k + 1) * 60) - 1;
+            $coord['hstop'] = ($coord['hstop'] > $hsp['Hsp_hit-to']) ? $hsp['Hsp_hit-to'] : $coord['hstop'];
+          
+          }
+          else {
+            $coord['hstop'] = $hsp['Hsp_hit-from'] - (($k + 1) * 60) + 1;
+            $coord['hstop'] = ($coord['hstop'] < $hsp['Hsp_hit-to']) ? $hsp['Hsp_hit-to'] : $coord['hstop'];
+          }
+          
+          // Pad these coordinates to ensure columned display.
+          foreach ($coord as $ck => $val) {
+            $pad_type = (preg_match('/start/', $ck)) ? STR_PAD_LEFT : STR_PAD_RIGHT;
+            $coord[$ck] = str_pad($val, $coord_length, '#', $pad_type);
+            $coord[$ck] =  str_replace('#', '&nbsp', $coord[$ck]);
+          }
       ?>
       ?>
         <div class="alignment-subrow">
         <div class="alignment-subrow">
           <div class="query">
           <div class="query">
@@ -82,12 +84,12 @@
             <span class="alignment-stop-coord"><?php print $coord['qstop']; ?></span>
             <span class="alignment-stop-coord"><?php print $coord['qstop']; ?></span>
           </div>
           </div>
           <div class="matches">
           <div class="matches">
-            <?php print	str_repeat('&nbsp;', 8); ?>
+            <?php print  str_repeat('&nbsp;', 8); ?>
             <?php print str_repeat('&nbsp;', $coord_length); ?>
             <?php print str_repeat('&nbsp;', $coord_length); ?>
             <span class="alignment-residues"><?php print str_replace(' ', '&nbsp', $matches[$k]); ?></span>
             <span class="alignment-residues"><?php print str_replace(' ', '&nbsp', $matches[$k]); ?></span>
           </div>
           </div>
           <div class="hit">
           <div class="hit">
-            <span class="alignment-title">Sbjct:</span>&nbsp;&nbsp;&nbsp;&nbsp;
+            <span class="alignment-title">Sbjct:</span>&nbsp;&nbsp;
             <span class="alignment-start-coord"><?php print $coord['hstart']; ?></span>
             <span class="alignment-start-coord"><?php print $coord['hstart']; ?></span>
             <span class="alignment-residues"><?php print $hit[$k]; ?></span>
             <span class="alignment-residues"><?php print $hit[$k]; ?></span>
             <span class="alignment-stop-coord"><?php print $coord['hstop']; ?></span>
             <span class="alignment-stop-coord"><?php print $coord['hstop']; ?></span>

+ 8 - 7
theme/blast_ui.theme.inc

@@ -24,17 +24,18 @@ function blast_ui_preprocess_show_blast_report(&$vars) {
   // Get the filename of the BLAST results
   // Get the filename of the BLAST results
   $job = tripal_get_job($vars['job_id']);
   $job = tripal_get_job($vars['job_id']);
   $job_args = unserialize($job->arguments);
   $job_args = unserialize($job->arguments);
-  $vars['xml_filename'] = variable_get('file_public_path', conf_path() . '/files') . '/' . $job_args['output_filename'] . '.blast.xml';
-  $vars['tsv_filename'] = variable_get('file_public_path', conf_path() . '/files') . '/' . $job_args['output_filename'] . '.blast.tsv';
-  $vars['html_filename'] = variable_get('file_public_path', conf_path() . '/files') . '/' . $job_args['output_filename'] . '.blast.html';
+//eksc- could stand better use of module settings and fewer hardcoded paths.
+  $vars['xml_filename'] = variable_get('file_public_path', conf_path() . '/files') . '/tripal/tripal_blast/' . $job_args['output_filename'] . '.blast.xml';
+  $vars['tsv_filename'] = variable_get('file_public_path', conf_path() . '/files') . '/tripal/tripal_blast/' . $job_args['output_filename'] . '.blast.tsv';
+  $vars['html_filename'] = variable_get('file_public_path', conf_path() . '/files') . '/tripal/tripal_blast/' . $job_args['output_filename'] . '.blast.html';
 
 
   // Add the blast database node.
   // Add the blast database node.
   // This is needed for link-out functionality.
   // This is needed for link-out functionality.
   $vars['blastdb'] = get_blast_database(array('path' => $job_args['database']));
   $vars['blastdb'] = get_blast_database(array('path' => $job_args['database']));
-	//@deepaksomanadh: code added to use the persisted data in the template file.
-	$job_id = $vars['job_id'];
-	$job_data = variable_get('job_data', '');
-	$vars['job_id_data'] = $job_data[$job_id];
+  //@deepaksomanadh: code added to use the persisted data in the template file.
+  $job_id = $vars['job_id'];
+  $job_data = variable_get('job_data', '');
+  $vars['job_id_data'] = $job_data[$job_id];
 }
 }
 
 
 /**
 /**

+ 16 - 18
theme/blast_user_menupage.tpl.php

@@ -7,20 +7,16 @@
 
 
 ?>
 ?>
 
 
-<p>In bioinformatics, BLAST (Basic Local Alignment Search Tool) is an algorithm
-for comparing primary biological sequence information, such as the amino-acid
-sequences of different proteins or the nucleotides of DNA sequences. A BLAST
-search enables a researcher to compare a query sequence with a library or
-database of sequences, and identify library sequences that resemble the query
-sequence above a certain threshold. Different types of BLASTs are available
-according to the query sequences. For example, following the discovery of a
-previously unknown gene in the mouse, a scientist will typically perform a
-BLAST search of the human genome to see if humans carry a similar gene;
-BLAST will identify sequences in the human genome that resemble the mouse
-gene based on similarity of sequence.</p>
-
-<blockquote>Altschul,S.F., Gish,W., Miller,W., Myers,E.W. and Lipman,D.J. (1990) Basic
-local alignment search tool. J. Mol. Biol., 215, 403–410.</blockquote>
+<h1> BLAST Search </h1>
+<p>
+  Search for one or more of your sequences (using BLAST). First pick 
+  a query type (nucleotide or protein). You will be able to set search 
+  parameters on the next page.
+</p>
+<p>
+  Choose the appropriate program based on the Query type and Target
+  database type. Please click on the program name to view the search form.
+<p>
 
 
 <table>
 <table>
   <tr>
   <tr>
@@ -31,23 +27,25 @@ local alignment search tool. J. Mol. Biol., 215, 403–410.</blockquote>
   <tr>
   <tr>
     <td  rowspan="2">Nucleotide</td>
     <td  rowspan="2">Nucleotide</td>
     <td>Nucleotide</td>
     <td>Nucleotide</td>
-    <td><?php print l('blastn', 'blast/nucleotide/nucleotide');?>:
+    <td><?php print l('blastn', './blast/nucleotide/nucleotide');?>:
       Search a nucleotide database using a nucleotide query.</td>
       Search a nucleotide database using a nucleotide query.</td>
   </tr>
   </tr>
   <tr>
   <tr>
     <td>Protein</td>
     <td>Protein</td>
-    <td><?php print l('blastx', 'blast/nucleotide/protein');?>:
+    <td><?php print l('blastx', './blast/nucleotide/protein');?>:
       Search protein database using a translated nucleotide query.</td>
       Search protein database using a translated nucleotide query.</td>
   </tr>
   </tr>
   <tr>
   <tr>
     <td  rowspan="2">Protein</td>
     <td  rowspan="2">Protein</td>
     <td>Nucleotide</td>
     <td>Nucleotide</td>
-    <td><?php print l('tblastn', 'blast/protein/nucleotide');?>:
+    <td><?php print l('tblastn', './blast/protein/nucleotide');?>:
       Search translated nucleotide database using a protein query.</td>
       Search translated nucleotide database using a protein query.</td>
   </tr>
   </tr>
   <tr>
   <tr>
     <td>Protein</td>
     <td>Protein</td>
-    <td><?php print l('blastp', 'blast/protein/protein');?>:
+    <td><?php print l('blastp', './blast/protein/protein');?>:
       Search protein database using a protein query.</td>
       Search protein database using a protein query.</td>
   </tr>
   </tr>
 </table>
 </table>
+
+<?php echo get_recent_jobs(); ?>

+ 5 - 0
theme/node--blastdb.tpl.php

@@ -97,7 +97,12 @@
 
 
     <table>
     <table>
       <tr><th>Human-Readable Name</th><td><?php print $node->db_name; ?></td></tr>
       <tr><th>Human-Readable Name</th><td><?php print $node->db_name; ?></td></tr>
+      <tr><th>Database Path</th><td><?php print $node->db_path; ?></td></tr>
       <tr><th>Database Type</th><td><?php print $node->db_dbtype; ?></td></tr>
       <tr><th>Database Type</th><td><?php print $node->db_dbtype; ?></td></tr>
+      <tr><th>FASTA Header Format</th><td><?php print $node->linkout->regex_type; ?></td></tr>
+      <tr><th>External Database</th><td><?php print $node->linkout->db_id->name; ?></td></tr>
+      <tr><th>RegEx</th><td><?php print $node->linkout->regex; ?></td></tr>
+      <tr><th>Link-out Type</th><td><?php print $node->linkout->type; ?></td></tr>
     </table>
     </table>
 
 
     <?php
     <?php