Sfoglia il codice sorgente

A couple of bug fixes and reformating of the recent jobs display into an easy to read table.

Lacey Sanderson 11 anni fa
parent
commit
d4a441473f

+ 52 - 29
api/blast_ui.api.inc

@@ -281,38 +281,61 @@ function get_blastdb_linkout_regex($node, $options = array()) {
   return $regex;
   return $regex;
 }
 }
 
 
-
-function get_recent_jobs() {
-  $html = '';
+/**
+ * Return a list of recent blast jobs to be displayed to the user.
+ *
+ * NOTE: The calling function will be expected to do the rendering.
+ *
+ * @return
+ *   An array of recent jobs.
+ */
+function get_recent_blast_jobs($programs = array()) {
   
   
+  $filter_jobs = !empty($programs);
+  
+  // Retrieve any recent jobs from the session variable.
   $sid = session_id();  
   $sid = session_id();  
-  $jobs = $_SESSION['all_jobs'][$sid];
-
-  // Remove jobs older than 48 hours
-  foreach ($jobs as $job_id => $job) {
-    if ($diff = abs(time() - strtotime($job['date'])) > 172800) {
-      unset($jobs[$job_id]);
+  if (isset($_SESSION['all_jobs'][$sid])) {
+
+    $jobs = array();
+    foreach ($_SESSION['all_jobs'][$sid] as $job_id => $job) {
+      $add = TRUE;
+      
+      // @TODO: Check that the results are still available.
+      // This is meant to replace the arbitrary only show jobs executed less than 48 hrs ago.
+      
+      // Remove jobs from the list that are not of the correct program.
+      if ($filter_jobs AND !in_array($job['program'], $programs)) {
+        $add = FALSE;
+      }
+      
+      if ($add) {
+
+        // Format the query information for display.
+        // Easiest case: if there is only one query header then show it.
+        if (sizeof($job['query_defs']) == 1 AND isset($job['query_defs'][0])) {
+          $job['query_info'] = $job['query_defs'][0];
+        }
+        // If we have at least one header then show that along with the count of queries.
+        elseif (isset($job['query_defs'][0])) {
+          $job['query_info'] = sizeof($job['query_defs']) . ' queries including "' . $job['query_defs'][0] . '"';
+        }
+        // If they provided a sequence with no header.
+        elseif (empty($job['query_defs'])) {
+          $job['query_info'] = 'Unnamed Query';
+        }
+        // At the very least show the count of queries.
+        else {
+          $job['query_info'] = sizeof($job['query_defs']) . ' queries';
+        }
+      
+        $jobs[$job_id] = $job;
+      }
     }
     }
+      
+    return $jobs;
   }
   }
-  $_SESSION['all_jobs'][$sid] = $jobs;
-  
-  if (count($jobs) > 0) {
-    $html = "
-    <h3><strong> Recent Jobs </h3>
-    <dl>";
-
-    foreach (array_reverse($jobs) as $job) {
-      $q_def = !isset($job['query_defs'][0]) ? "Query" : $job['query_defs'][0];
-      $html .= "
-        <dd>
-          <a href='" . "../../" . $job['job_output_url'] ."'>
-            $q_def X " . $job['target'] . ' (' . $job['program'] . ') - ' . $job['date'] . "
-          </a>
-        </dd>";
-    }
-     $html .= "
-    </dl>";
+  else {
+    return array();
   }
   }
-  
-  return $html;
 }
 }

+ 0 - 33
blast_ui.module

@@ -249,39 +249,6 @@ function show_blast_output($job_id) {
   return '';
   return '';
 }
 }
 
 
-/**
- *
- */
-function ajax_blast_ui_example_sequence_callback($form, $form_state) {
-  $sequence_type = $form_state['values']['query_type'];
-  if ($sequence_type == 'nucleotide') {
-    $default_example_sequence = variable_get('blast_ui_nucleotide_example_sequence', 'sample');
-  }
-  elseif ($sequence_type == 'protein') {
-    $default_example_sequence = variable_get('blast_ui_protein_example_sequence', 'sample');
-  }
-  else {
-    $default_example_sequence = 'unknown query type';
-  }
-
-  // If the Show Example checkbox is true then put the example in the textfield
-  if ($form_state['values']['example_sequence']) {
-    // Set the value to be the example sequence (either set by the administrator
-    // or the default set above).
-    $form['query']['FASTA']['#value'] = variable_get(
-      'blast_ui_' . $sequence_type . '_example_sequence',
-      $default_example_sequence
-    );
-  }
-  // Otherwise we want to remove the already displayed example.
-  else {
-    $form['query']['FASTA']['#value'] = '';
-  }
-
-  return $form['query']['FASTA'];
-}
-
-
 /**
 /**
  * Enable web services API
  * Enable web services API
  *
  *

+ 33 - 20
includes/blast_ui.admin.inc

@@ -21,29 +21,38 @@ function blast_ui_admin_form($form, $form_state) {
     '#description' => t('You can ignore if your $PATH variable is set. Otherwise, enter the absoulte path to bin folder. For example, /opt/blast/2.2.29+/bin/'),
     '#description' => t('You can ignore if your $PATH variable is set. Otherwise, enter the absoulte path to bin folder. For example, /opt/blast/2.2.29+/bin/'),
     '#default_value' => variable_get('blast_path', ''),
     '#default_value' => variable_get('blast_path', ''),
   );
   );
-
-  $form['general']['target_upload'] = array(
-    '#type' => 'checkbox',
-    '#title' => 'Enable Taget Sequence Upload',
-    '#default_value' => FALSE,
-    '#description' => 'When this option is checked, a file upload field will '
-      . 'show up on the various BLAST forms under the Database section. This '
-      . 'will allow users to upload a FASTA file they want to BLAST against '
-      . '(database) as well as a FASTA file containing their query, providing '
-      . 'the ultimate in flexibility for your users. However, since this does '
-      . 'allow & in fact encourage the upload of large files which are then '
-      . 'processed into BLAST databases, this option is disabled by default.',
-    '#default_value' => variable_get(
-        'blast_ui_allow_target_upload',
-        FALSE
-      )
-  );
+  
 	$form['general']['blast_threads']= array(
 	$form['general']['blast_threads']= array(
     '#type' => 'textfield',
     '#type' => 'textfield',
     '#title' => t('Enter the number of CPU threads to use in blast search.'),
     '#title' => t('Enter the number of CPU threads to use in blast search.'),
     '#description' => t('You can increase the number to reduce the search time. Before you increase, please check your hardware configurations . A value of one(1) can result in a slower search for some programs eg. tblastn.'),
     '#description' => t('You can increase the number to reduce the search time. Before you increase, please check your hardware configurations . A value of one(1) can result in a slower search for some programs eg. tblastn.'),
     '#default_value' => variable_get('blast_threads', 1),
     '#default_value' => variable_get('blast_threads', 1),
   );
   );
+  
+  $form['file_upload'] = array(
+    '#type' => 'fieldset',
+    '#title' => 'Allow File Upload',
+    '#description' => 'The following options allow you to control whether your users can
+      upload files for the query or target respectively. The ability to upload files allows
+      them to more conviently BLAST large sets of sequences. However, the size of the
+      files could be problematic, storage-wise, on your server.<br />'
+  );
+  
+  $form['file_upload']['query_upload'] = array(
+    '#type' => 'checkbox',
+    '#title' => 'Enable Query Sequence Upload',
+    '#description' => 'When checked, a query file upload field will be available on BLAST request forms.',
+    '#default_value' => FALSE,
+    '#default_value' => variable_get('blast_ui_allow_query_upload', TRUE)
+  );
+
+  $form['file_upload']['target_upload'] = array(
+    '#type' => 'checkbox',
+    '#title' => 'Enable Taget Sequence Upload',
+    '#description' => 'When checked, a target file upload field will be available on BLAST request forms.',
+    '#default_value' => FALSE,
+    '#default_value' => variable_get('blast_ui_allow_target_upload', FALSE)
+  );
 
 
   $form['example_sequence'] = array(
   $form['example_sequence'] = array(
     '#type' => 'fieldset',
     '#type' => 'fieldset',
@@ -116,7 +125,7 @@ KRSLEEGLKTTGEGLDWGVLFGFGPGLTIETVVLRSVAI';
 }
 }
 
 
 /**
 /**
- * Form validator for the blastdb node
+ * Validate the Admin/Settings form.
  */
  */
 function blast_ui_admin_form_validate($form, &$form_state) {
 function blast_ui_admin_form_validate($form, &$form_state) {
 	$blast_path = $form_state['values']['blast_path'];
 	$blast_path = $form_state['values']['blast_path'];
@@ -133,12 +142,16 @@ function blast_ui_admin_form_validate($form, &$form_state) {
 }
 }
 
 
 /**
 /**
- *
+ * Submit the Admin/settings form.
  */
  */
 function blast_ui_admin_form_submit($form, $form_state) {
 function blast_ui_admin_form_submit($form, $form_state) {
+
   variable_set('blast_path', $form_state['values']['blast_path']);
   variable_set('blast_path', $form_state['values']['blast_path']);
+  variable_set('blast_threads', $form_state['values']['blast_threads']);
+  
+  variable_set('blast_ui_allow_query_upload', $form_state['values']['query_upload']);	
   variable_set('blast_ui_allow_target_upload', $form_state['values']['target_upload']);
   variable_set('blast_ui_allow_target_upload', $form_state['values']['target_upload']);
-	variable_set('blast_threads', $form_state['values']['blast_threads']);
+  
   variable_set('blast_ui_nucleotide_example_sequence', $form_state['values']['nucleotide_example']);
   variable_set('blast_ui_nucleotide_example_sequence', $form_state['values']['nucleotide_example']);
   variable_set('blast_ui_protein_example_sequence', $form_state['values']['protein_example']);
   variable_set('blast_ui_protein_example_sequence', $form_state['values']['protein_example']);
 }
 }

+ 5 - 5
includes/blast_ui.form_advanced_options.inc

@@ -151,7 +151,7 @@ function blast_ui_blastn_advanced_options_form_submit($form, $form_state) {
     'reward'          => $m_m['reward'],
     'reward'          => $m_m['reward'],
     'culling_limit'   => $qRange,
     'culling_limit'   => $qRange,
   );
   );
-}//blast_ui_blastn_advanced_options_form_submit
+}
 
 
 /**
 /**
  * @section
  * @section
@@ -235,7 +235,7 @@ function blast_ui_blastx_advanced_options_form(&$form, $form_state) {
     '#type' => 'select',
     '#type' => 'select',
     '#title' => 'Matrix',
     '#title' => 'Matrix',
     '#options' => $matrix_options,
     '#options' => $matrix_options,
-    '#default_value' => $default['matrix'],
+    '#default_value' => $defaults['matrix'],
     '#description' => t('Assigns a score for aligning pairs of residues, and determines overall alignment score..'),
     '#description' => t('Assigns a score for aligning pairs of residues, and determines overall alignment score..'),
     '#ajax' => array(
     '#ajax' => array(
       'callback' => 'ajax_dependent_dropdown_callback',
       'callback' => 'ajax_dependent_dropdown_callback',
@@ -415,7 +415,7 @@ function blast_ui_blastp_advanced_options_form(&$form, $form_state) {
     '#description' => t('Matrix adjustment method to compensate for amino acid composition of sequences'),
     '#description' => t('Matrix adjustment method to compensate for amino acid composition of sequences'),
   );
   );
 */
 */
-}//blast_ui_blastp_advanced_options_form
+}
 
 
 /**
 /**
  * Validate the advanced options provided by the BLASTp form above.
  * Validate the advanced options provided by the BLASTp form above.
@@ -1045,7 +1045,7 @@ function blast_ui_tblastn_advanced_options_form(&$form, $form_state) {
     '#title' => t('Gap Costs:'),
     '#title' => t('Gap Costs:'),
     '#prefix' => '<div id="dropdown-second-replace">',
     '#prefix' => '<div id="dropdown-second-replace">',
     '#suffix' => '</div>',
     '#suffix' => '</div>',
-    '#options' => _get_gap_for_matrix($$default['matrix']),
+    '#options' => _get_gap_for_matrix($defaults['matrix']),
     '#default_value' => 2,
     '#default_value' => 2,
     '#description' => t('Cost to create and extend a gap in an alignment.'),
     '#description' => t('Cost to create and extend a gap in an alignment.'),
   );
   );
@@ -1058,7 +1058,7 @@ function blast_ui_tblastn_advanced_options_form(&$form, $form_state) {
     '#maxlength' => 20,
     '#maxlength' => 20,
     '#description' => t('Limit the number of matches to a query range. This option is useful if many strong matches to one part of a query may prevent BLAST from presenting weaker matches to another part of the query.'),
     '#description' => t('Limit the number of matches to a query range. This option is useful if many strong matches to one part of a query may prevent BLAST from presenting weaker matches to another part of the query.'),
   );
   );
-}//blast_ui_tblastn_advanced_options_form
+}
 
 
 /**
 /**
  * Validate the advanced options provided by the tBLASTn form above.
  * Validate the advanced options provided by the tBLASTn form above.

+ 117 - 39
includes/blast_ui.form_per_program.inc

@@ -20,6 +20,10 @@ function blast_ui_per_blast_program_form($form, $form_state) {
     drupal_get_path('module', 'blast_ui') . '/theme/css/form.css',
     drupal_get_path('module', 'blast_ui') . '/theme/css/form.css',
   );
   );
   
   
+  // We are going to lay out this form as two choices: either look at a recent blast
+  // or execute a new one. We want to theme accordingly so set a class to aid us in such.
+  $form['#attributes'] = array('class' => array('blast-choice-form'));
+  
   // @deepaksomanadh - Code added for edit and resubmit funcitonality
   // @deepaksomanadh - Code added for edit and resubmit funcitonality
   //   Approach: persist the form data and read it back using JobID
   //   Approach: persist the form data and read it back using JobID
   $job_data = variable_get('job_data', '');
   $job_data = variable_get('job_data', '');
@@ -30,7 +34,7 @@ function blast_ui_per_blast_program_form($form, $form_state) {
     $job_data = array();
     $job_data = array();
     $jid = 0;
     $jid = 0;
   }
   }
-  
+
   // Determine the BLAST program.
   // Determine the BLAST program.
   $query_type = $form_state['build_info']['args'][0];
   $query_type = $form_state['build_info']['args'][0];
   $db_type = $form_state['build_info']['args'][1];
   $db_type = $form_state['build_info']['args'][1];
@@ -75,10 +79,57 @@ function blast_ui_per_blast_program_form($form, $form_state) {
     '#value' => $blast_program
     '#value' => $blast_program
   );
   );
 
 
+  // CHOOSE RECENT BLAST RESULTS
+  //-----------------------------------
+  // Gets the list of recent jobs filtered to the current blast program (ie: blastn).
+  $recent_jobs = get_recent_blast_jobs(array($blast_program));
+  
+  // If there are recent jobs then show a table of them.
+  if ($recent_jobs) {
+
+    $form['A'] = array(
+      '#type' => 'fieldset',
+      '#title' => 'See Results from a Recent BLAST',
+      '#attributes' => array('class' => array('blast-choice')),
+      '#collapsible' => TRUE,
+      '#collapsed' => TRUE
+    );
+    
+    $table = array(
+      'header' => array('Query Information', 'Search Target', 'Date Requested', ''),
+      'rows' => array(),
+      'attributes' => array('class' => array('tripal-blast', 'recent-jobs')),
+    );
+      
+    foreach ($recent_jobs as $job) {
+
+      // Define a row for the current job.
+      $table['rows'][] = array(
+        $job['query_info'],
+        $job['target'],
+        $job['date'],
+        l('See Results', $job['job_output_url'])
+      );
+    }
+
+    $form['A']['job_table'] = array(
+      '#type' => 'markup',
+      '#markup' => theme('table', $table),
+    );
+  }
+
+  // REQUEST A NEW BLAST
+  //-----------------------------------
+  $form['B'] = array(
+    '#type' => 'fieldset',
+    '#title' => 'Request a New BLAST',
+    '#attributes' => array('class' => array('blast-choice')),
+    '#collapsible' => TRUE,
+  );
+     
   // NUCLEOTIDE QUERY
   // NUCLEOTIDE QUERY
   //.........................
   //.........................
-
-  $form['query'] = array(
+  $form['B']['query'] = array(
     '#type' => 'fieldset',
     '#type' => 'fieldset',
     '#title' => t('Enter %type Query Sequence',
     '#title' => t('Enter %type Query Sequence',
       array('%type' => ucfirst($query_type))),
       array('%type' => ucfirst($query_type))),
@@ -95,13 +146,13 @@ function blast_ui_per_blast_program_form($form, $form_state) {
   );
   );
 
 
   // Checkbox to show an example.
   // Checkbox to show an example.
-  $form['query']['example_sequence'] = array(
+  $form['B']['query']['example_sequence'] = array(
     '#type' => 'checkbox',
     '#type' => 'checkbox',
     '#title' => t('Show an Example Sequence'),
     '#title' => t('Show an Example Sequence'),
     '#prefix' => '<span style="float: right;">',
     '#prefix' => '<span style="float: right;">',
     '#suffix' => '</span>',
     '#suffix' => '</span>',
     '#ajax' => array(
     '#ajax' => array(
-      'callback' => 'ajax_blast_ui_example_sequence_callback',
+      'callback' => 'ajax_blast_ui_perprogram_example_sequence_callback',
       'wrapper'  => 'fasta-textarea',
       'wrapper'  => 'fasta-textarea',
       'method'   => 'replace',
       'method'   => 'replace',
       'effect'   => 'fade',
       'effect'   => 'fade',
@@ -109,7 +160,7 @@ function blast_ui_per_blast_program_form($form, $form_state) {
   );
   );
 
 
   // Textfield for submitting a mult-FASTA query
   // Textfield for submitting a mult-FASTA query
-  $form['query']['FASTA'] = array(
+  $form['B']['query']['FASTA'] = array(
     '#type' => 'textarea',
     '#type' => 'textarea',
     '#title' => t('Enter FASTA sequence(s)'),
     '#title' => t('Enter FASTA sequence(s)'),
     '#description'=>t('Enter query sequence(s) in the text area.'),
     '#description'=>t('Enter query sequence(s) in the text area.'),
@@ -118,33 +169,33 @@ function blast_ui_per_blast_program_form($form, $form_state) {
     '#suffix' => '</div>',
     '#suffix' => '</div>',
   );
   );
 
 
-/*TODO: FIX THIS! Shouldn't come up if not selected in configuration
-  // Upload a file as an alternative to enter a query sequence
-  $form['#attributes']['enctype'] = 'multipart/form-data';
-  $form['query']['UPLOAD'] = array(
-    '#title' => 'Or upload your own query FASTA:  ',
-    '#type' => 'managed_file',
-    '#description' => t('The file should be a plain-text FASTA
-(.fasta, .fna, .fa, .fas) file. In other words, it cannot have formatting as is the
-case with MS Word (.doc, .docx) or Rich Text Format (.rtf). It cannot be greater
-than %max_size in size. <strong>Don\'t forget to press the Upload button before
-attempting to submit your BLAST.</strong>',
-      array(
-        '%max_size' => round(file_upload_max_size() / 1024 / 1024,1) . 'MB'
-      )
-    ),
-    '#upload_validators' => array(
-      'file_validate_extensions' => array('fasta fna fa fas'),
-      'file_validate_size' => array(file_upload_max_size()),
-    ),
-  );
-*/
+  if (variable_get('blast_ui_allow_query_upload', TRUE)) {
+    // Upload a file as an alternative to enter a query sequence
+    $form['#attributes']['enctype'] = 'multipart/form-data';
+    $form['B']['query']['UPLOAD'] = array(
+      '#title' => 'Or upload your own query FASTA:  ',
+      '#type' => 'managed_file',
+      '#description' => t('The file should be a plain-text FASTA
+  (.fasta, .fna, .fa, .fas) file. In other words, it cannot have formatting as is the
+  case with MS Word (.doc, .docx) or Rich Text Format (.rtf). It cannot be greater
+  than %max_size in size. <strong>Don\'t forget to press the Upload button before
+  attempting to submit your BLAST.</strong>',
+        array(
+          '%max_size' => round(file_upload_max_size() / 1024 / 1024,1) . 'MB'
+        )
+      ),
+      '#upload_validators' => array(
+        'file_validate_extensions' => array('fasta fna fa fas'),
+        'file_validate_size' => array(file_upload_max_size()),
+      ),
+    );
+  }
 
 
 
 
   // BLAST DATABASE
   // BLAST DATABASE
   //.........................
   //.........................
 
 
-  $form['DB'] = array(
+  $form['B']['DB'] = array(
     '#type' => 'fieldset',
     '#type' => 'fieldset',
     '#title' => t('Choose Search Target'),
     '#title' => t('Choose Search Target'),
     '#description' => t('Choose from one of the %type BLAST databases listed '
     '#description' => t('Choose from one of the %type BLAST databases listed '
@@ -157,7 +208,7 @@ attempting to submit your BLAST.</strong>',
   );
   );
 
 
   $options = get_blast_database_options($db_type);
   $options = get_blast_database_options($db_type);
-  $form['DB']['SELECT_DB'] = array(
+  $form['B']['DB']['SELECT_DB'] = array(
     '#type' => 'select',
     '#type' => 'select',
     '#title' => t('%type BLAST Databases:', array('%type' => ucfirst($db_type))),
     '#title' => t('%type BLAST Databases:', array('%type' => ucfirst($db_type))),
     '#options' => $options,
     '#options' => $options,
@@ -167,7 +218,7 @@ attempting to submit your BLAST.</strong>',
   if (variable_get('blast_ui_allow_target_upload', FALSE)) {
   if (variable_get('blast_ui_allow_target_upload', FALSE)) {
     // Upload a file as an alternative to selecting an existing BLAST database
     // Upload a file as an alternative to selecting an existing BLAST database
     $form['#attributes']['enctype'] = 'multipart/form-data';
     $form['#attributes']['enctype'] = 'multipart/form-data';
-    $form['DB']['DBUPLOAD'] = array(
+    $form['B']['DB']['DBUPLOAD'] = array(
       '#title' => 'Or upload your own dataset:  ',
       '#title' => 'Or upload your own dataset:  ',
       '#type' => 'managed_file',
       '#type' => 'managed_file',
       '#description' => t('The file should be a plain-text FASTA
       '#description' => t('The file should be a plain-text FASTA
@@ -192,7 +243,7 @@ attempting to submit your BLAST.</strong>',
   // These options will be different depending upon the program selected.
   // These options will be different depending upon the program selected.
   // Therefore, allow for program-specific callbacks to populate these options.
   // Therefore, allow for program-specific callbacks to populate these options.
 
 
-  $form['ALG'] = array(
+  $form['B']['ALG'] = array(
    '#type' => 'fieldset',
    '#type' => 'fieldset',
    '#title' => t('Advanced Options'),
    '#title' => t('Advanced Options'),
    '#collapsible' => TRUE,
    '#collapsible' => TRUE,
@@ -203,19 +254,15 @@ attempting to submit your BLAST.</strong>',
   if (function_exists($advanced_options_form)) {
   if (function_exists($advanced_options_form)) {
     call_user_func_array($advanced_options_form, array(&$form, $form_state));
     call_user_func_array($advanced_options_form, array(&$form, $form_state));
   }
   }
+  $form['B']['ALG'] = array_merge($form['B']['ALG'], $form['ALG']);
+  unset($form['ALG']);
 
 
   // Submit
   // Submit
   //.........................
   //.........................
-  $form['submit'] = array(
+  $form['B']['submit'] = array(
     '#type' => 'submit',
     '#type' => 'submit',
     '#default_value' => ' BLAST ',
     '#default_value' => ' BLAST ',
   );
   );
-
-  // Recent jobs list
-  $form['recentjobs'] = array(
-     '#type' => 'fieldset',
-     '#prefix' => get_recent_jobs(),
-   );
    
    
   return $form;
   return $form;
 }
 }
@@ -507,4 +554,35 @@ your sequence headers include pipes (i.e.: | ) they adhere to '
     $msg .= "Please contact the site administrator.";
     $msg .= "Please contact the site administrator.";
     drupal_set_message($msg, 'error');
     drupal_set_message($msg, 'error');
   }
   }
-}//blast_ui_per_blast_program_form_submit
+}
+
+/**
+ * AJAX: Replace the sequence textarea with one containing an example.
+ */
+function ajax_blast_ui_perprogram_example_sequence_callback($form, $form_state) {
+  $sequence_type = $form_state['values']['query_type'];
+  
+  // Choose the example sequence based on the sequence type of the query.
+  if ($sequence_type == 'nucleotide') {
+    $example_sequence = variable_get('blast_ui_nucleotide_example_sequence', 'sample');
+  }
+  elseif ($sequence_type == 'protein') {
+    $example_sequence = variable_get('blast_ui_protein_example_sequence', 'sample');
+  }
+  else {
+    $example_sequence = 'unknown query type';
+  }
+
+  // If the Show Example checkbox is true then put the example in the textfield
+  if ($form_state['values']['example_sequence']) {
+
+    // Set the value to be the example sequence (set in the admin form).
+    $form['B']['query']['FASTA']['#value'] = $example_sequence;
+  }
+  // Otherwise we want to remove the already displayed example.
+  else {
+    $form['B']['query']['FASTA']['#value'] = '';
+  }
+
+  return $form['B']['query']['FASTA'];
+}

+ 39 - 1
theme/blast_nucleotide_user_menupage.tpl.php

@@ -28,6 +28,14 @@ gene based on similarity of sequence.</p>
 <blockquote>Altschul,S.F., Gish,W., Miller,W., Myers,E.W. and Lipman,D.J. (1990) Basic
 <blockquote>Altschul,S.F., Gish,W., Miller,W., Myers,E.W. and Lipman,D.J. (1990) Basic
 local alignment search tool. J. Mol. Biol., 215, 403–410.</blockquote>
 local alignment search tool. J. Mol. Biol., 215, 403–410.</blockquote>
 
 
+<h2> BLAST Search </h2>
+<p>
+  Search for one or more of your sequences (using BLAST). First pick 
+  a query type (nucleotide or protein). You will be able to set search 
+  parameters on the next page. Choose the appropriate program based on the Query type and Target
+  database type. Please click on the program name to view the search form.
+<p>
+
 <table>
 <table>
   <tr>
   <tr>
     <th>Query Type</th>
     <th>Query Type</th>
@@ -56,4 +64,34 @@ local alignment search tool. J. Mol. Biol., 215, 403–410.</blockquote>
     <td><?php print l('blastp', './blast/protein/protein');?>:
     <td><?php print l('blastp', './blast/protein/protein');?>:
       Search protein database using a protein query.</td>
       Search protein database using a protein query.</td>
   </tr>
   </tr>
-</table>
+</table>
+
+<!-- Recent Jobs -->
+<?php
+
+  // Gets the list of recent jobs filtered to the current blast program (ie: blastn).
+  $recent_jobs = get_recent_blast_jobs(array('blastn','blastx'));
+  if ($recent_jobs) {
+  
+    print '<h2>Recent Jobs</h2>';
+    
+    $table = array(
+      'header' => array('Query Information', 'Search Target', 'Date Requested', ''),
+      'rows' => array(),
+      'attributes' => array('class' => array('tripal-blast', 'recent-jobs')),
+    );
+  
+    foreach ($recent_jobs as $job) {
+
+      // Define a row for the current job.
+      $table['rows'][] = array(
+        $job['query_info'],
+        $job['target'],
+        $job['date'],
+        l('See Results', $job['job_output_url'])
+      );
+    }
+    
+    print theme('table', $table);
+  }
+?>

+ 39 - 1
theme/blast_protein_user_menupage.tpl.php

@@ -27,6 +27,14 @@ gene based on similarity of sequence.</p>
 <blockquote>Altschul,S.F., Gish,W., Miller,W., Myers,E.W. and Lipman,D.J. (1990) Basic
 <blockquote>Altschul,S.F., Gish,W., Miller,W., Myers,E.W. and Lipman,D.J. (1990) Basic
 local alignment search tool. J. Mol. Biol., 215, 403–410.</blockquote>
 local alignment search tool. J. Mol. Biol., 215, 403–410.</blockquote>
 
 
+<h2> BLAST Search </h2>
+<p>
+  Search for one or more of your sequences (using BLAST). First pick 
+  a query type (nucleotide or protein). You will be able to set search 
+  parameters on the next page. Choose the appropriate program based on the Query type and Target
+  database type. Please click on the program name to view the search form.
+<p>
+
 <table>
 <table>
   <tr>
   <tr>
     <th>Query Type</th>
     <th>Query Type</th>
@@ -55,4 +63,34 @@ local alignment search tool. J. Mol. Biol., 215, 403–410.</blockquote>
     <td><?php print l('blastp', './blast/protein/protein');?>:
     <td><?php print l('blastp', './blast/protein/protein');?>:
       Search protein database using a protein query.</td>
       Search protein database using a protein query.</td>
   </tr>
   </tr>
-</table>
+</table>
+
+<!-- Recent Jobs -->
+<?php
+
+  // Gets the list of recent jobs filtered to the current blast program (ie: blastn).
+  $recent_jobs = get_recent_blast_jobs(array('tblastn','blastp'));
+  if ($recent_jobs) {
+  
+    print '<h2>Recent Jobs</h2>';
+    
+    $table = array(
+      'header' => array('Query Information', 'Search Target', 'Date Requested', ''),
+      'rows' => array(),
+      'attributes' => array('class' => array('tripal-blast', 'recent-jobs')),
+    );
+  
+    foreach ($recent_jobs as $job) {
+
+      // Define a row for the current job.
+      $table['rows'][] = array(
+        $job['query_info'],
+        $job['target'],
+        $job['date'],
+        l('See Results', $job['job_output_url'])
+      );
+    }
+    
+    print theme('table', $table);
+  }
+?>

+ 30 - 1
theme/blast_report.tpl.php

@@ -360,4 +360,33 @@ else {
 <p> 
 <p> 
   <a style ="align:center" href="<?php print '../../'. $job_id_data['job_url'] . '?jid=' . base64_encode($job_id) ?>">Edit this query and re-submit</a>  
   <a style ="align:center" href="<?php print '../../'. $job_id_data['job_url'] . '?jid=' . base64_encode($job_id) ?>">Edit this query and re-submit</a>  
 </p>
 </p>
-<?php echo get_recent_jobs(); ?>
+
+<!-- Recent Jobs -->
+<?php
+
+  // Gets the list of recent jobs filtered to the current blast program (ie: blastn).
+  $recent_jobs = get_recent_blast_jobs();
+  if ($recent_jobs) {
+  
+    print '<h2>Recent Jobs</h2>';
+    
+    $table = array(
+      'header' => array('Query Information', 'Search Target', 'Date Requested', ''),
+      'rows' => array(),
+      'attributes' => array('class' => array('tripal-blast', 'recent-jobs')),
+    );
+  
+    foreach ($recent_jobs as $job) {
+
+      // Define a row for the current job.
+      $table['rows'][] = array(
+        $job['query_info'],
+        $job['target'],
+        $job['date'],
+        l('See Results', $job['job_output_url'])
+      );
+    }
+    
+    print theme('table', $table);
+  }
+?>

+ 49 - 8
theme/blast_user_menupage.tpl.php

@@ -7,14 +7,26 @@
 
 
 ?>
 ?>
 
 
-<h1> BLAST Search </h1>
+<p>In bioinformatics, BLAST (Basic Local Alignment Search Tool) is an algorithm
+for comparing primary biological sequence information, such as the amino-acid
+sequences of different proteins or the nucleotides of DNA sequences. A BLAST
+search enables a researcher to compare a query sequence with a library or
+database of sequences, and identify library sequences that resemble the query
+sequence above a certain threshold. Different types of BLASTs are available
+according to the query sequences. For example, following the discovery of a
+previously unknown gene in the mouse, a scientist will typically perform a
+BLAST search of the human genome to see if humans carry a similar gene;
+BLAST will identify sequences in the human genome that resemble the mouse
+gene based on similarity of sequence.</p>
+
+<blockquote>Altschul,S.F., Gish,W., Miller,W., Myers,E.W. and Lipman,D.J. (1990) Basic
+local alignment search tool. J. Mol. Biol., 215, 403–410.</blockquote>
+
+<h2> BLAST Search </h2>
 <p>
 <p>
   Search for one or more of your sequences (using BLAST). First pick 
   Search for one or more of your sequences (using BLAST). First pick 
   a query type (nucleotide or protein). You will be able to set search 
   a query type (nucleotide or protein). You will be able to set search 
-  parameters on the next page.
-</p>
-<p>
-  Choose the appropriate program based on the Query type and Target
+  parameters on the next page. Choose the appropriate program based on the Query type and Target
   database type. Please click on the program name to view the search form.
   database type. Please click on the program name to view the search form.
 <p>
 <p>
 
 
@@ -25,7 +37,7 @@
     <th>BLAST Program</th>
     <th>BLAST Program</th>
   </tr>
   </tr>
   <tr>
   <tr>
-    <td  rowspan="2">Nucleotide</td>
+    <td  rowspan="2"><?php print l('Nucleotide', './blast/nucleotide');?></td>
     <td>Nucleotide</td>
     <td>Nucleotide</td>
     <td><?php print l('blastn', './blast/nucleotide/nucleotide');?>:
     <td><?php print l('blastn', './blast/nucleotide/nucleotide');?>:
       Search a nucleotide database using a nucleotide query.</td>
       Search a nucleotide database using a nucleotide query.</td>
@@ -36,7 +48,7 @@
       Search protein database using a translated nucleotide query.</td>
       Search protein database using a translated nucleotide query.</td>
   </tr>
   </tr>
   <tr>
   <tr>
-    <td  rowspan="2">Protein</td>
+    <td  rowspan="2"><?php print l('Protein', './blast/protein');?></td>
     <td>Nucleotide</td>
     <td>Nucleotide</td>
     <td><?php print l('tblastn', './blast/protein/nucleotide');?>:
     <td><?php print l('tblastn', './blast/protein/nucleotide');?>:
       Search translated nucleotide database using a protein query.</td>
       Search translated nucleotide database using a protein query.</td>
@@ -48,4 +60,33 @@
   </tr>
   </tr>
 </table>
 </table>
 
 
-<?php echo get_recent_jobs(); ?>
+<!-- Recent Jobs -->
+<?php
+
+  // Gets the list of recent jobs filtered to the current blast program (ie: blastn).
+  $recent_jobs = get_recent_blast_jobs();
+  if ($recent_jobs) {
+  
+    print '<h2>Recent Jobs</h2>';
+    
+    $table = array(
+      'header' => array('Query Information', 'Search Target', 'Date Requested', ''),
+      'rows' => array(),
+      'attributes' => array('class' => array('tripal-blast', 'recent-jobs')),
+    );
+  
+    foreach ($recent_jobs as $job) {
+
+      // Define a row for the current job.
+      $table['rows'][] = array(
+        $job['query_info'],
+        $job['target'],
+        $job['date'],
+        l('See Results', $job['job_output_url'])
+      );
+    }
+    
+    print theme('table', $table);
+  }
+?>
+