Browse Source

Merge pull request #2 from laceysanderson/cvitjs

Improvements to CViTjs embbeding
ekcannon 7 years ago
parent
commit
e4657d8613

+ 4 - 0
.gitignore

@@ -0,0 +1,4 @@
+
+# Ignore an internal CViTjs installation.
+# Assumes it's been cloned in the js directory
+js/*

+ 42 - 3
api/blast_ui.api.inc

@@ -875,14 +875,53 @@ function printGFF_parent_children ($gff,$blast_feature_array){
 /**
 /**
  * Get text from cvitjs conf file, if possible.
  * Get text from cvitjs conf file, if possible.
  *
  *
+ * @param $genome_target
+ *   The section of the config to return. Should consist of "data."+[blastdb name].
+ *
  * @return
  * @return
  *   A string containing the entire contents of the cvitjs configuration file. FALSE otherwise.
  *   A string containing the entire contents of the cvitjs configuration file. FALSE otherwise.
  */
  */
-function blast_ui_get_cvit_conf_text() {
-  if ($cvit_conf=blast_ui_get_cvit_conf(variable_get('blast_ui_cvitjs_location', false))) {
-    if ($contents=file_get_contents($cvit_conf)) {
+function blast_ui_get_cvit_conf_text($genome_target = FALSE) {
+
+  // Retrieve the full path and filename of the conf.
+  $cvit_conf = blast_ui_get_cvit_conf(variable_get('blast_ui_cvitjs_location', false));
+  if ($cvit_conf) {
+
+    // Retrieve the contents of the file.
+    $contents = file_get_contents($cvit_conf);
+
+    // If no genome target was provided then return the full file.
+    if ($contents && $genome_target == FALSE) {
       return $contents;
       return $contents;
     }
     }
+
+    // If a genome target was provided, then only return that section.
+    if ($genome_target) {
+      $section = array();
+      $in_section = FALSE;
+
+      // For each line of the configuration file...
+      $section_header = '['.$genome_target.']';
+      $lines = preg_split('/\r\n|\n|\r/', trim($contents));
+      foreach($lines as $l) {
+
+        // Are we in the section for this genome target?
+        if (trim($l) == $section_header) {
+          $in_section = TRUE; }
+
+        // Id so and we haven't fallen out of it through an empty line,
+        // then add it to saved section for returning.
+        if ($in_section) {
+          if (trim($l) == '') { break; }
+          $section[] = trim($l);
+        }
+      }
+
+      // If we found the section, then return it ;-).
+      if (!empty($section)) {
+        return implode("\n", $section);
+      }
+    }
   }
   }
 
 
   return false;
   return false;

+ 14 - 5
includes/blast_ui.admin.inc

@@ -152,36 +152,45 @@ KRSLEEGLKTTGEGLDWGVLFGFGPGLTIETVVLRSVAI';
   );
   );
 
 
   // CVITJS
   // CVITJS
+  $cvitjs_enabled = variable_get('blast_ui_cvitjs_enabled', FALSE);
+  $cvitjs_location = variable_get('blast_ui_cvitjs_location', '');
   $description = 'The JavaScript program CViTjs enables users to see BLAST hits on an '
   $description = 'The JavaScript program CViTjs enables users to see BLAST hits on an '
                . 'entire genome assembly. See the help tab for information on how to '
                . 'entire genome assembly. See the help tab for information on how to '
                . 'download and set up CViTjs.';
                . 'download and set up CViTjs.';
+
   $form['cvitjs'] = array(
   $form['cvitjs'] = array(
     '#type' => 'fieldset',
     '#type' => 'fieldset',
     '#collapsible' => true,
     '#collapsible' => true,
-    '#collapsed' => true,
+    '#collapsed' => !$cvitjs_enabled,
     '#title' => 'Enable and configure genome visualization',
     '#title' => 'Enable and configure genome visualization',
     '#description' => $description,
     '#description' => $description,
   );
   );
 
 
-  $description = 'CViTjs is only applicable for genome BLAST targets. After it is '
+  $absolute_cvitjs_data_path = DRUPAL_ROOT . '/' . drupal_get_path('module','blast_ui') . '/' . $cvitjs_location . '/data';
+  $description = '<div class ="messages warning">CViTjs is only applicable for genome BLAST targets. After it is '
                . 'enabled here, CViTjs will need to be enabled for each applicable BLAST '
                . 'enabled here, CViTjs will need to be enabled for each applicable BLAST '
-              . 'target node.';
+              . 'target node.</div>'
+              . '<div class="messages status"><strong>CViTjs Data Location: '.$absolute_cvitjs_data_path.'</strong>'
+              . '<br />The GFF3 and Genome Target-specific CViTjs configuration files should be located'
+              . 'at the above system path. Feel free to organize this directory further.</div>';
   $form['cvitjs']['explanation'] = array(
   $form['cvitjs']['explanation'] = array(
     '#markup' => t($description),
     '#markup' => t($description),
   );
   );
 
 
+
   $form['cvitjs']['cvitjs_enabled'] = array(
   $form['cvitjs']['cvitjs_enabled'] = array(
     '#type' => 'checkbox',
     '#type' => 'checkbox',
     '#title' => 'Enable CViTjs',
     '#title' => 'Enable CViTjs',
     '#description' => 'When checked, CViTjs will be enabled.',
     '#description' => 'When checked, CViTjs will be enabled.',
-    '#default_value' => variable_get('blast_ui_cvitjs_enabled', FALSE)
+    '#default_value' => $cvitjs_enabled,
   );
   );
 
 
   $form['cvitjs']['cvitjs_location'] = array(
   $form['cvitjs']['cvitjs_location'] = array(
     '#type' => 'textfield',
     '#type' => 'textfield',
     '#title' => 'Path to CViTjs code',
     '#title' => 'Path to CViTjs code',
     '#description' => 'Path is relative to the location of this module. Example: js/cvitjs',
     '#description' => 'Path is relative to the location of this module. Example: js/cvitjs',
-    '#default_value' => variable_get('blast_ui_cvitjs_location', '')
+    '#default_value' => $cvitjs_location,
+    '#disabled' => !$cvitjs_enabled,
   );
   );
 
 
   // Get CViTjs confuration text, if possible.
   // Get CViTjs confuration text, if possible.

+ 45 - 28
includes/blast_ui.node.inc

@@ -67,7 +67,7 @@ function blastdb_form($node, &$form_state) {
   $form = array();
   $form = array();
 
 
   $form['#validate'] = array('blastdb_form_validate');
   $form['#validate'] = array('blastdb_form_validate');
-  
+
   $form['#attached']['css'] = array(
   $form['#attached']['css'] = array(
     drupal_get_path('module', 'blast_ui') . '/theme/css/form.css',
     drupal_get_path('module', 'blast_ui') . '/theme/css/form.css',
   );
   );
@@ -106,7 +106,7 @@ function blastdb_form($node, &$form_state) {
   $form['dbxref'] = array(
   $form['dbxref'] = array(
     '#type' => 'fieldset',
     '#type' => 'fieldset',
     '#title' => 'Link-outs',
     '#title' => 'Link-outs',
-    '#description' => 'These settings will be used to <em>transform the hit name into a 
+    '#description' => 'These settings will be used to <em>transform the hit name into a
       link to additional information</em>.',
       link to additional information</em>.',
     '#prefix' => '<div id="link-outs">',
     '#prefix' => '<div id="link-outs">',
     '#suffix' => '</div>',
     '#suffix' => '</div>',
@@ -122,13 +122,13 @@ function blastdb_form($node, &$form_state) {
   $form['dbxref']['dbxref_linkout_type'] = array(
   $form['dbxref']['dbxref_linkout_type'] = array(
     '#type' => 'radios',
     '#type' => 'radios',
     '#title' => 'Link-out Type',
     '#title' => 'Link-out Type',
-    '#description' => 'This determines how the URL to be linked to is formed. <strong>Make 
-      sure the database chosen supports this type of link</strong> (ie: the database 
+    '#description' => 'This determines how the URL to be linked to is formed. <strong>Make
+      sure the database chosen supports this type of link</strong> (ie: the database
       should point to a GBrowse instance if you choose GBrowse here).',
       should point to a GBrowse instance if you choose GBrowse here).',
     '#options' => $options,
     '#options' => $options,
     '#default_value' => $linkout_type,
     '#default_value' => $linkout_type,
   );
   );
-  
+
   // Add information about each format to the description.
   // Add information about each format to the description.
   if ($linkout_type) {
   if ($linkout_type) {
     $form['dbxref']['dbxref_linkout_type']['#description'] .= '
     $form['dbxref']['dbxref_linkout_type']['#description'] .= '
@@ -229,7 +229,7 @@ function blastdb_form($node, &$form_state) {
       '#default_value' => (isset($node->linkout->db_id->db_id)) ? $node->linkout->db_id->db_id : 0
       '#default_value' => (isset($node->linkout->db_id->db_id)) ? $node->linkout->db_id->db_id : 0
     );
     );
   }
   }
-    
+
   // CViTjs settings, if enabled
   // CViTjs settings, if enabled
   if (variable_get('blast_ui_cvitjs_enabled', false)) {
   if (variable_get('blast_ui_cvitjs_enabled', false)) {
     $form['cvitjs'] = array(
     $form['cvitjs'] = array(
@@ -239,29 +239,33 @@ function blastdb_form($node, &$form_state) {
       '#prefix' => '<div id="cvitjs-settings">',
       '#prefix' => '<div id="cvitjs-settings">',
       '#suffix' => '</div>',
       '#suffix' => '</div>',
     );
     );
-    
+
     $form['cvitjs']['cvitjs_enabled'] = array(
     $form['cvitjs']['cvitjs_enabled'] = array(
       '#type' => 'checkbox',
       '#type' => 'checkbox',
       '#title' => t('Show BLAST hits on the genome in the results page.'),
       '#title' => t('Show BLAST hits on the genome in the results page.'),
       '#description' => t('Uses CViTjs to display BLAST hits on the entire genome'),
       '#description' => t('Uses CViTjs to display BLAST hits on the entire genome'),
       '#default_value' => (isset($node->cvitjs_enabled)) ? $node->cvitjs_enabled : false,
       '#default_value' => (isset($node->cvitjs_enabled)) ? $node->cvitjs_enabled : false,
-//      '#ajax' => array(
-//        'callback' => 'ajax_blast_ui_node_cvitjs_custom_callback',
-//        'wrapper' => 'cvitjs-settings',
-//      )
     );
     );
-
-    if (isset($form_state['values'])) {
-      $cvitjs_enabled = $form_state['values']['cvitjs_enabled'];
-    }
-    else if (isset($node->cvitjs_enabled))  {
-      $cvitjs_enabled = $node->cvitjs_enabled;
+    $cvitjs_msg_class = 'blastdb-extra-info';
+    $cvitjs_msg = 'Target Genome Configuration should be under <strong>[data.'.$node->db_name.']</strong> in the main cvit.conf.';
+
+    $conf_section = blast_ui_get_cvit_conf_text('data.'.$node->db_name);
+    if (!$conf_section) {
+      $cvitjs_msg_class .= ' messages warning';
+      $cvitjs_msg .= '<br /><br />There is no section for this genome target defined in the CViTjs
+        configuration file. <strong>No genome visualization will be shown until you define a
+        configuration section, "[data.'.$form_state['values']['db_name'].']", at '
+        .l('Admin > Tripal > Extensions > Tripal BLAST > BLAST UI', 'admin/tripal/extension/tripal_blast')
+        .'</strong>.';
     }
     }
     else {
     else {
-      $cvitjs_enabled = false;
+      $cvitjs_msg .= '<br /><br /><strong>Current Configuration:</strong><pre>'.$conf_section.'</pre>';
     }
     }
+
+    $form['cvitjs']['cvitjs_enabled']['#description'] .= '<div class="'.$cvitjs_msg_class.'">'.$cvitjs_msg.'</p>';
+
   }
   }
-  
+
   return $form;
   return $form;
 }
 }
 
 
@@ -296,6 +300,19 @@ function blastdb_form_validate($form, $form_state) {
       );
       );
     }
     }
   }
   }
+
+  // Check that there is a cvitjs section for the current
+  if ($form_state['values']['cvitjs_enabled']) {
+    $conf_section = blast_ui_get_cvit_conf_text('data.'.$form_state['values']['db_name']);
+    if (!$conf_section) {
+      drupal_set_message('There is no section for this genome target defined in the CViTjs
+        configuration file. <strong>No genome visualization will be shown until you define a
+        configuration section, "[data.'.$form_state['values']['db_name'].']", at '
+        .l('Admin > Tripal > Extensions > Tripal BLAST > BLAST UI', 'admin/tripal/extension/tripal_blast')
+        .'</strong>.',
+      'warning');
+    }
+  }
 }
 }
 
 
 /**
 /**
@@ -313,7 +330,7 @@ function blastdb_insert($node) {
       $regex = $node->dbxref_id_type;
       $regex = $node->dbxref_id_type;
     }
     }
   }
   }
-  
+
   $db_id = 0;
   $db_id = 0;
   if (isset($node->db_id)) {
   if (isset($node->db_id)) {
     $db_id = $node->db_id;
     $db_id = $node->db_id;
@@ -326,7 +343,7 @@ function blastdb_insert($node) {
   if (!isset($node->cvitjs_enabled)) {
   if (!isset($node->cvitjs_enabled)) {
     $node->cvitjs_enabled = 0;
     $node->cvitjs_enabled = 0;
   }
   }
-    
+
   // Actually insert the record.
   // Actually insert the record.
   db_insert('blastdb')->fields(array(
   db_insert('blastdb')->fields(array(
     'nid'                 => $node->nid,
     'nid'                 => $node->nid,
@@ -365,7 +382,7 @@ function blastdb_update($node) {
       $regex = $node->dbxref_id_type;
       $regex = $node->dbxref_id_type;
     }
     }
   }
   }
-  
+
   $db_id = 0;
   $db_id = 0;
   if (isset($node->db_id)) {
   if (isset($node->db_id)) {
     $db_id = $node->db_id;
     $db_id = $node->db_id;
@@ -374,11 +391,11 @@ function blastdb_update($node) {
   if (!$node->cvitjs_enabled) {
   if (!$node->cvitjs_enabled) {
     $node->cvitjs_enabled = 0;
     $node->cvitjs_enabled = 0;
   }
   }
-    
+
   if (!$node->dbxref_linkout_type) {
   if (!$node->dbxref_linkout_type) {
     $node->dbxref_linkout_type = 'none';
     $node->dbxref_linkout_type = 'none';
   }
   }
-  
+
   // Update the record.
   // Update the record.
   db_update('blastdb')->fields(array(
   db_update('blastdb')->fields(array(
     'name'                => $node->db_name,
     'name'                => $node->db_name,
@@ -414,9 +431,9 @@ function blastdb_delete($node) {
 function blastdb_load($nodes) {
 function blastdb_load($nodes) {
 
 
   $sql = "
   $sql = "
-    SELECT nid, name, path, dbtype, dbxref_id_regex, dbxref_db_id, 
+    SELECT nid, name, path, dbtype, dbxref_id_regex, dbxref_db_id,
            dbxref_linkout_type, cvitjs_enabled
            dbxref_linkout_type, cvitjs_enabled
-    FROM {blastdb} 
+    FROM {blastdb}
     WHERE nid IN (:nids)";
     WHERE nid IN (:nids)";
   $result = db_query($sql, array(':nids' => array_keys($nodes)));
   $result = db_query($sql, array(':nids' => array_keys($nodes)));
 
 
@@ -441,7 +458,7 @@ function blastdb_load($nodes) {
       tripal_report_error(
       tripal_report_error(
         'blast_ui',
         'blast_ui',
         TRIPAL_ERROR,
         TRIPAL_ERROR,
-        'Unable to find details on the type of link-out choosen (%type). Have you defined hook_blast_linkout_info()? Make sure to clear the cache once you do so.',       
+        'Unable to find details on the type of link-out choosen (%type). Have you defined hook_blast_linkout_info()? Make sure to clear the cache once you do so.',
         array('%type' => $record->dbxref_linkout_type)
         array('%type' => $record->dbxref_linkout_type)
       );
       );
     }
     }
@@ -494,7 +511,7 @@ function blastdb_load($nodes) {
       // Support complex link-outs.
       // Support complex link-outs.
       $nodes[$record->nid]->linkout->type = $record->dbxref_linkout_type;
       $nodes[$record->nid]->linkout->type = $record->dbxref_linkout_type;
       $nodes[$record->nid]->linkout->url_function = $type['process function'];
       $nodes[$record->nid]->linkout->url_function = $type['process function'];
-   
+
     }
     }
     // If there is no linkout then provide some defaults.
     // If there is no linkout then provide some defaults.
     else {
     else {

+ 67 - 58
theme/blast_help.tpl.php

@@ -16,7 +16,7 @@
 <p>This module provides a basic interface to allow your users to utilize your server's NCBI BLAST+.</p>
 <p>This module provides a basic interface to allow your users to utilize your server's NCBI BLAST+.</p>
 
 
 <p>
 <p>
-  <a href="#setup">Setup</a> | <a href="#function">Functionality</a> 
+  <a href="#setup">Setup</a> | <a href="#function">Functionality</a>
   | <a href="#protection">Large jobs | <a href="#genomeview">Genome visualization</a>
   | <a href="#protection">Large jobs | <a href="#genomeview">Genome visualization</a>
 </p>
 </p>
 
 
@@ -25,32 +25,32 @@
 <h3><b>Setup Instructions</b></h3>
 <h3><b>Setup Instructions</b></h3>
 <ol>
 <ol>
   <li>
   <li>
-    Install NCBI BLAST+ on your server (Tested with 2.2.26+). There is a 
-    <a href="https://launchpad.net/ubuntu/+source/ncbi-blast+">package available 
-    for Ubuntu</a> to ease installation. Optionally you can set the path to your 
+    Install NCBI BLAST+ on your server (Tested with 2.2.26+). There is a
+    <a href="https://launchpad.net/ubuntu/+source/ncbi-blast+">package available
+    for Ubuntu</a> to ease installation. Optionally you can set the path to your
     BLAST executable <a href="<?php print url('admin/tripal/extension/tripal_blast/blast_ui');?>">
     BLAST executable <a href="<?php print url('admin/tripal/extension/tripal_blast/blast_ui');?>">
     in the settings</a>.
     in the settings</a>.
   </li>
   </li>
   <li>
   <li>
-    Optionally, create Tripal External Database References to allow you to link 
-    the records in your BLAST database to further information. To do this simply 
-    go to <a href="<?php print url('admin/tripal/chado/tripal_db/add'); ?>" target="_blank">Tripal> 
-    Chado Modules > Databases > Add DB</a> and make sure to fill in the Database 
-    prefix which will be concatenated with the record IDs in your BLAST database 
-    to determine the link-out to additional information. Note that a regular 
-    expression can be used when creating the BLAST database to indicate what the 
+    Optionally, create Tripal External Database References to allow you to link
+    the records in your BLAST database to further information. To do this simply
+    go to <a href="<?php print url('admin/tripal/chado/tripal_db/add'); ?>" target="_blank">Tripal>
+    Chado Modules > Databases > Add DB</a> and make sure to fill in the Database
+    prefix which will be concatenated with the record IDs in your BLAST database
+    to determine the link-out to additional information. Note that a regular
+    expression can be used when creating the BLAST database to indicate what the
     ID is.
     ID is.
   </li>
   </li>
   <li>
   <li>
-    <a href="<?php print url('node/add/blastdb');?>">Create "BLAST Database" 
-    nodes</a> for each dataset you want to make available for your users to BLAST 
-    against. BLAST databases should first be created using the command-line 
-    <code>makeblastdb</code> program with the <code>-parse_seqids</code> flag.  
+    <a href="<?php print url('node/add/blastdb');?>">Create "BLAST Database"
+    nodes</a> for each dataset you want to make available for your users to BLAST
+    against. BLAST databases should first be created using the command-line
+    <code>makeblastdb</code> program with the <code>-parse_seqids</code> flag.
   </li>
   </li>
   <li>
   <li>
-    It's recommended that you also install the <a href="http://drupal.org/project/tripal_daemon">Tripal Job Daemon</a> 
-    to manage BLAST jobs and ensure they are run soon after being submitted by the 
-    user. Without this additional module, administrators will have to execute the 
+    It's recommended that you also install the <a href="http://drupal.org/project/tripal_daemon">Tripal Job Daemon</a>
+    to manage BLAST jobs and ensure they are run soon after being submitted by the
+    user. Without this additional module, administrators will have to execute the
     tripal jobs either manually or through use of cron jobs.
     tripal jobs either manually or through use of cron jobs.
   </li>
   </li>
 </ol>
 </ol>
@@ -59,33 +59,33 @@
 &mdash;
 &mdash;
 <h3><b>Highlighted Functionality</b></h3>
 <h3><b>Highlighted Functionality</b></h3>
 <ul>
 <ul>
-  <li>Supports <a href="<?php print url('blast/nucleotide/nucleotide');?>">blastn</a>, 
-    <a href="<?php print url('blast/nucleotide/protein');?>">blastx</a>, 
-    <a href="<?php print url('blast/protein/protein');?>">blastp</a> and 
+  <li>Supports <a href="<?php print url('blast/nucleotide/nucleotide');?>">blastn</a>,
+    <a href="<?php print url('blast/nucleotide/protein');?>">blastx</a>,
+    <a href="<?php print url('blast/protein/protein');?>">blastp</a> and
     <a href="<?php print url('blast/protein/nucleotide');?>">tblastx</a> with separate forms depending upon the database/query type.
     <a href="<?php print url('blast/protein/nucleotide');?>">tblastx</a> with separate forms depending upon the database/query type.
   </li>
   </li>
   <li>
   <li>
-    Simple interface allowing users to paste or upload a query sequence and then 
-    select from available databases. Additionally, a FASTA file can be uploaded 
+    Simple interface allowing users to paste or upload a query sequence and then
+    select from available databases. Additionally, a FASTA file can be uploaded
     for use as a database to BLAST against (this functionality can be disabled).
     for use as a database to BLAST against (this functionality can be disabled).
   </li>
   </li>
   <li>
   <li>
-    Tabular Results listing with alignment information and multiple download 
+    Tabular Results listing with alignment information and multiple download
     formats (HTML, TSV, XML) available.
     formats (HTML, TSV, XML) available.
   </li>
   </li>
   <li>
   <li>
-    Completely integrated with <a href="<?php print url('admin/tripal/tripal_jobs');?>">Tripal Jobs</a> 
-    providing administrators with a way to track BLAST jobs and ensuring long 
+    Completely integrated with <a href="<?php print url('admin/tripal/tripal_jobs');?>">Tripal Jobs</a>
+    providing administrators with a way to track BLAST jobs and ensuring long
     running BLASTs will not cause page time-outs
     running BLASTs will not cause page time-outs
   </li>
   </li>
   <li>
   <li>
-    BLAST databases are made available to the module by 
-    <a href="<?php print url('node/add/blastdb');?>">creating Drupal Pages</a> 
-    describing them. This allows administrators to 
+    BLAST databases are made available to the module by
+    <a href="<?php print url('node/add/blastdb');?>">creating Drupal Pages</a>
+    describing them. This allows administrators to
     <a href="<?php print url('admin/structure/types/manage/blastdb/fields');?>">use the Drupal Field API to add any information they want to these pages</a>.
     <a href="<?php print url('admin/structure/types/manage/blastdb/fields');?>">use the Drupal Field API to add any information they want to these pages</a>.
   </li>
   </li>
   <li>
   <li>
-    BLAST database records can be linked to an external source with more 
+    BLAST database records can be linked to an external source with more
     information (ie: NCBI) per BLAST database.
     information (ie: NCBI) per BLAST database.
   </li>
   </li>
 </ul>
 </ul>
@@ -93,17 +93,17 @@
 <a name="protection"</a></a>
 <a name="protection"</a></a>
 &mdash;
 &mdash;
 <h3><b>Protection Against Large Jobs</b></h3>
 <h3><b>Protection Against Large Jobs</b></h3>
-Depending on the size and nature of your target databases, you may wish to constrain use 
+Depending on the size and nature of your target databases, you may wish to constrain use
 of this module.
 of this module.
 <ol>
 <ol>
   <li>Limit the number of results displayed via admin page. The recommended number is 500.</li>
   <li>Limit the number of results displayed via admin page. The recommended number is 500.</li>
   <li>
   <li>
-    Limit the maximum upload file size in php settings. This is less useful because some 
+    Limit the maximum upload file size in php settings. This is less useful because some
     very large queries may be manageable, and others not.
     very large queries may be manageable, and others not.
   </li>
   </li>
   <li>
   <li>
-    Repeat-mask your targets, or provide repeat-masked versions. Note that some 
-    researchers may be looking for repeats, so this may limit the usefulness of the BLAST 
+    Repeat-mask your targets, or provide repeat-masked versions. Note that some
+    researchers may be looking for repeats, so this may limit the usefulness of the BLAST
     service.
     service.
   </li>
   </li>
 </ol>
 </ol>
@@ -111,19 +111,21 @@ of this module.
 <a name="genomeview"></a>
 <a name="genomeview"></a>
 &mdash;
 &mdash;
 <h3><b>Whole Genome Visualization</b></h3>
 <h3><b>Whole Genome Visualization</b></h3>
-This module can be configured to use 
-<a href="https://github.com/LegumeFederation/cvitjs">CViTjs</a> to display BLAST hits on 
-a genome image. The process is as follows:
+This module can be configured to use
+<a href="https://github.com/LegumeFederation/cvitjs">CViTjs</a> to display BLAST hits on
+a genome image.
+
+<h4>CViTjs Setup</h4>
 <ol>
 <ol>
   <li>
   <li>
     <a href="https://github.com/LegumeFederation/cvitjs">Download CViTjs</a> and copy
     <a href="https://github.com/LegumeFederation/cvitjs">Download CViTjs</a> and copy
     the code to your webserver. It might make the most sense to put the code directly into
     the code to your webserver. It might make the most sense to put the code directly into
-    this module's directory, in a subdirectory named <code>js/</code>. To download, execute 
+    this module's directory, in a subdirectory named <code>js/</code>. To download, execute
     the git command inside the <code>js/</code> subdirectory:<br>
     the git command inside the <code>js/</code> subdirectory:<br>
     <code>git clone https://github.com/LegumeFederation/cvitjs.git</code>
     <code>git clone https://github.com/LegumeFederation/cvitjs.git</code>
   </li>
   </li>
   <li>
   <li>
-    CViTjs will have a config file in its root directory named cvit.conf. This file 
+    CViTjs will have a config file in its root directory named cvit.conf. This file
     provides information for whole genome visualization for each genome BLAST target.
     provides information for whole genome visualization for each genome BLAST target.
     <b>Make sure the config file can be edited by your web server.</b>
     <b>Make sure the config file can be edited by your web server.</b>
   </li>
   </li>
@@ -135,7 +137,7 @@ a genome image. The process is as follows:
   </li>
   </li>
   <li>
   <li>
     Enable CViTjs from the BLAST module administration page and provide the path to the
     Enable CViTjs from the BLAST module administration page and provide the path to the
-    root directory for the CViTjs code relative to this module. For example, 
+    root directory for the CViTjs code relative to this module. For example,
     <code>js/cvitjs</code>.
     <code>js/cvitjs</code>.
   </li>
   </li>
   <li>
   <li>
@@ -148,20 +150,11 @@ defaultData = data/cajca/cajca.gff</pre>
     <ul>
     <ul>
       <li>the section name, "data.Cajanus cajan - genome", consists of "data." followed
       <li>the section name, "data.Cajanus cajan - genome", consists of "data." followed
           by the name of the BLAST target node,</li>
           by the name of the BLAST target node,</li>
-      <li>the file "cajca.conf" is a cvit configuration file which describes how to draw the 
+      <li>the file "cajca.conf" is a cvit configuration file which describes how to draw the
           chromosomes and BLAST hits on the <i>Cajanus cajan</i> genome,</li>
           chromosomes and BLAST hits on the <i>Cajanus cajan</i> genome,</li>
-      <li>and the file "cajca.gff" is a GFF3 file that describes the <i>Cajanus cajan</i> 
+      <li>and the file "cajca.gff" is a GFF3 file that describes the <i>Cajanus cajan</i>
           chromosomes.</li>
           chromosomes.</li>
     </ul>
     </ul>
-    The .conf file for each genome can be modified to suit your needs and tastes. See the
-    sample configuration file, <code>data/test1/test1.conf</code>, and the CViTjs
-    <a href="https://github.com/LegumeFederation/cvitjs#using-cvitjs">documentation</a>
-    
-    You will have to put the target-specific conf and gff files (e.g. cajca.conf and 
-    cjca.gff) on your web server, in the directory, <code>js/cvitjs/data</code>. You may 
-    choose to group files for each genome into subdirectories, for example, 
-    <code>js/cvitjs/data/cajca</code>.
-    <br><br>
     At the top of the configuration file there must be a [general] section that defines
     At the top of the configuration file there must be a [general] section that defines
     the default data set. For example:
     the default data set. For example:
     <pre>
     <pre>
@@ -169,15 +162,31 @@ defaultData = data/cajca/cajca.gff</pre>
 data_default = data.Cajanus cajan - genome</pre>
 data_default = data.Cajanus cajan - genome</pre>
   </li>
   </li>
   <li>
   <li>
-    Edit the nodes for each genome target (nodes of type "BLAST Database") and enable whole 
-    genome visualization. Remember that the names listed in the CViTjs config file must 
+    Edit the nodes for each genome target (nodes of type "BLAST Database") and enable whole
+    genome visualization. Remember that the names listed in the CViTjs config file must
     match the BLAST node name. In the example above, the BLAST database node for the
     match the BLAST node name. In the example above, the BLAST database node for the
     <i>Cajanus cajan</i> genome assembly is named "Cajanus cajan - genome"
     <i>Cajanus cajan</i> genome assembly is named "Cajanus cajan - genome"
   </li>
   </li>
 </ol>
 </ol>
 
 
-It is important to make sure that cvit.conf points to the correct data directory and the
-correct .gff and .conf files for the genome in question. For more information about how to 
-create the .gff file, see the 
-<a href="https://github.com/LegumeFederation/cvitjs#how-to">documentation</a>.
-
+<h4>Notes</h4>
+<ul>
+<li>The .conf file for each genome can be modified to suit your needs and tastes. See the
+  sample configuration file, <code>data/test1/test1.conf</code>, and the CViTjs
+  <a href="https://github.com/LegumeFederation/cvitjs#using-cvitjs">documentation</a>.</li>
+<li>Each blast target CViTjs configuration file must define how to visualize blast hits or you will not see them.
+  <pre>[blast]
+feature = BLASTRESULT:match_part
+glyph   = position
+shape = rect
+color   = #FF00FF
+width = 5</pre></li>
+<li>You will have to put the target-specific conf and gff files (e.g. cajca.conf and
+  cjca.gff) on your web server, in the directory, <code>js/cvitjs/data</code>. You may
+  choose to group files for each genome into subdirectories, for example,
+  <code>js/cvitjs/data/cajca</code>.</li>
+<li>It is important to make sure that cvit.conf points to the correct data directory and the
+  correct .gff and .conf files for the genome in question. For more information about how to
+  create the .gff file, see the
+  <a href="https://github.com/LegumeFederation/cvitjs#how-to">documentation</a>.</li>
+</ul>

+ 11 - 34
theme/blast_report.tpl.php

@@ -62,7 +62,6 @@ $no_hits = TRUE;
 
 
 <div class="blast-report">
 <div class="blast-report">
 
 
-  <div class="blast-job-info">
     <!-- Provide Information to the user about their blast job -->
     <!-- Provide Information to the user about their blast job -->
     <div class="blast-job-info">
     <div class="blast-job-info">
       <div class="blast-download-info"><strong>Download</strong>:
       <div class="blast-download-info"><strong>Download</strong>:
@@ -72,13 +71,13 @@ $no_hits = TRUE;
         <a href="<?php print '../../' . $blast_job->files->result->gff; ?>">GFF3</a>
         <a href="<?php print '../../' . $blast_job->files->result->gff; ?>">GFF3</a>
       </div>
       </div>
       <br />
       <br />
-      <div class="blast-query-info"><strong>Query Information</strong>: 
+      <div class="blast-query-info"><strong>Query Information</strong>:
         <?php print $blast_job->files->query;?></div>
         <?php print $blast_job->files->query;?></div>
-      <div class="blast-target-info"><strong>Search Target</strong>: 
+      <div class="blast-target-info"><strong>Search Target</strong>:
         <?php print $blast_job->blastdb->db_name;?></div>
         <?php print $blast_job->blastdb->db_name;?></div>
-      <div class="blast-date-info"><strong>Submission Date</strong>: 
+      <div class="blast-date-info"><strong>Submission Date</strong>:
         <?php print format_date($blast_job->date_submitted, 'medium');?></div>
         <?php print format_date($blast_job->date_submitted, 'medium');?></div>
-      <div class="blast-cmd-info"><strong>BLAST Command executed</strong>: 
+      <div class="blast-cmd-info"><strong>BLAST Command executed</strong>:
         <?php print $blast_job->blast_cmd;?></div>
         <?php print $blast_job->blast_cmd;?></div>
       <br />
       <br />
       <div class="num-results">
       <div class="num-results">
@@ -87,42 +86,18 @@ $no_hits = TRUE;
     </div>
     </div>
 
 
     <?php
     <?php
-      if (variable_get('blast_ui_cvitjs_enabled', false)
-            && isset($blast_job->blastdb->cvitjs_enabled)
-            && $blast_job->blastdb->cvitjs_enabled == '1') {
-        $cvitjs_location = variable_get('blast_ui_cvitjs_location', '');
+      if ($show_cvit_diagram) {
     ?>
     ?>
       <!-- CViTjs image of BLAST hits, if enabled -->
       <!-- CViTjs image of BLAST hits, if enabled -->
       <div class="cvitjs">
       <div class="cvitjs">
-        <div id="title-div"></div>
+        <div id="title-div"><h2>Whole Genome Visualization of BLAST hits</h2></div>
         <div id="cvit-div"></div>
         <div id="cvit-div"></div>
       </div>
       </div>
-      <?php
-        drupal_add_js(array(
-          'blast_ui'=> array(
-            'dataset' => $blast_job->blastdb->db_name)
-          ),
-          'setting'
-        );
-        drupal_add_js(array(
-          'blast_ui'=> array(
-            'gff' => '../../' . $blast_job->files->result->gff)),'setting'
-        );    
-        $base = drupal_get_path('module','blast_ui') 
-                . DIRECTORY_SEPARATOR . $cvitjs_location
-                . DIRECTORY_SEPARATOR . 'js'
-                . DIRECTORY_SEPARATOR . 'lib' . DIRECTORY_SEPARATOR;
-        drupal_add_css($base.'bootstrap/css/bootstrap.min.css',array('preprocess'=>FALSE));
-        drupal_add_css($base.'hopscotch/css/hopscotch.min.css',array('preprocess'=>FALSE));
-        drupal_add_css($base.'../../css/cvit.css',array('preprocess'=> FALSE));
-        drupal_add_js($base.'require/require.js',array('group'=>'JS_LIBRARY','type'=>'file'));
-        drupal_add_js($base.'require/blast_ui-config.js',array('group'=>'JS_THEME'));
-      ?>
-    <?php  
+
+    <?php
       }
       }
     ?>
     ?>
 
 
-  </div>
   <br />
   <br />
 
 
   <div class="report-table">
   <div class="report-table">
@@ -135,6 +110,8 @@ $no_hits = TRUE;
     if ($xml) {
     if ($xml) {
     ?>
     ?>
 
 
+    <h2>Resulting BLAST hits</h2>
+
     <p>The following table summarizes the results of your BLAST.
     <p>The following table summarizes the results of your BLAST.
     Click on a <em>triangle </em> on the left to see the alignment and a visualization of the hit,
     Click on a <em>triangle </em> on the left to see the alignment and a visualization of the hit,
     and click the <em>target name </em> to get more information about the target hit.</p>
     and click the <em>target name </em> to get more information about the target hit.</p>
@@ -243,7 +220,7 @@ $no_hits = TRUE;
                               ';';
                               ';';
                 $Hsp_bit_score .=   $hsp_xml->{'Hsp_bit-score'} .';';
                 $Hsp_bit_score .=   $hsp_xml->{'Hsp_bit-score'} .';';
               }
               }
-              
+
               // Finally record the range.
               // Finally record the range.
               // @todo figure out why we arbitrarily subtract 50,000 here...
               // @todo figure out why we arbitrarily subtract 50,000 here...
               // @more removing the 50,000 and using track start/end appears to cause no change...
               // @more removing the 50,000 and using track start/end appears to cause no change...

+ 33 - 2
theme/blast_ui.theme.inc

@@ -30,6 +30,37 @@ function blast_ui_preprocess_show_blast_report(&$vars) {
       $vars['blast_job']->blast_cmd .= ' -' . $key. ' ' . $value ;
       $vars['blast_job']->blast_cmd .= ' -' . $key. ' ' . $value ;
   }
   }
 
 
+  // CViTjs
+  $vars['show_cvit_diagram'] = FALSE;
+  if (variable_get('blast_ui_cvitjs_enabled', false)
+    && isset($vars['blast_job']->blastdb->cvitjs_enabled)
+    && $vars['blast_job']->blastdb->cvitjs_enabled == '1') {
+
+    // Set a clean var so we don't have to do this long check again ;-).
+    $vars['show_cvit_diagram'] = TRUE;
+
+    // Add the CSS/JS.
+    $cvitjs_location = variable_get('blast_ui_cvitjs_location', '');
+    $base = drupal_get_path('module','blast_ui')
+           . DIRECTORY_SEPARATOR . $cvitjs_location
+           . DIRECTORY_SEPARATOR . 'js'
+           . DIRECTORY_SEPARATOR . 'lib' . DIRECTORY_SEPARATOR;
+    drupal_add_css($base.'bootstrap_embed/css/bootstrap.min.css',array('preprocess'=>FALSE));
+    drupal_add_css($base.'hopscotch/css/hopscotch.min.css',array('preprocess'=>FALSE));
+    drupal_add_css($base.'../../css/cvit.css',array('preprocess'=> FALSE));
+    drupal_add_js($base.'require/require.js',array('group'=>'JS_LIBRARY','type'=>'file'));
+    drupal_add_js($base.'require/blast_ui-config.js',array('group'=>'JS_THEME'));
+
+    // Add the JS settings.
+    global $base_url;
+    drupal_add_js(array('blast_ui'=> array(
+            'dataset' => $vars['blast_job']->blastdb->db_name,
+            'gff' => $base_url . '/' . $vars['blast_job']->files->result->gff
+      )),
+      'setting'
+    );
+  }
+
   // Determine the URL of the blast form.
   // Determine the URL of the blast form.
   $vars['blast_form_url'] = 'blast/nucleotide/nucleotide';
   $vars['blast_form_url'] = 'blast/nucleotide/nucleotide';
   switch($vars['blast_job']->program) {
   switch($vars['blast_job']->program) {
@@ -129,7 +160,7 @@ function blast_ui_reveal_secret($secret) {
   // Check that the job_id exists if it is an integer.
   // Check that the job_id exists if it is an integer.
   if (is_numeric($job_id)) {
   if (is_numeric($job_id)) {
 
 
-    $exists = db_query('SELECT job_id FROM {tripal_jobs} WHERE job_id=:id', 
+    $exists = db_query('SELECT job_id FROM {tripal_jobs} WHERE job_id=:id',
                        array(':id' => $job_id))->fetchField();
                        array(':id' => $job_id))->fetchField();
     if (!$exists) {
     if (!$exists) {
       tripal_report_error(
       tripal_report_error(
@@ -148,7 +179,7 @@ function blast_ui_reveal_secret($secret) {
 
 
     $job_id = base64_decode($secret);
     $job_id = base64_decode($secret);
     if (is_numeric($job_id)) {
     if (is_numeric($job_id)) {
-      $exists = db_query('SELECT job_id FROM {tripal_jobs} WHERE job_id=:id', 
+      $exists = db_query('SELECT job_id FROM {tripal_jobs} WHERE job_id=:id',
                          array(':id' => $job_id))->fetchField();
                          array(':id' => $job_id))->fetchField();
       if (!$exists) {
       if (!$exists) {
         tripal_report_error(
         tripal_report_error(

+ 6 - 0
theme/css/blast_report.css

@@ -77,9 +77,15 @@ table#blast_report div.alignment-subrow{
 }
 }
 .blast-job-info {
 .blast-job-info {
   float: left;
   float: left;
+  margin-bottom: 25px;
 }
 }
 .cvitjs {
 .cvitjs {
   float: left;
   float: left;
+  margin-top: 10px;
+  margin-bottom: 25px;
+}
+.cvitjs #cvit-div{
+  padding: 5px 0 0 0;
 }
 }
 .report-table {
 .report-table {
   clear: both;
   clear: both;

+ 23 - 0
theme/node--blastdb.tpl.php

@@ -105,8 +105,31 @@
       <tr><th>RegEx</th><td><?php print $node->linkout->regex; ?></td></tr>
       <tr><th>RegEx</th><td><?php print $node->linkout->regex; ?></td></tr>
       <tr><th>Link-out Type</th><td><?php print $node->linkout->type; ?></td></tr>
       <tr><th>Link-out Type</th><td><?php print $node->linkout->type; ?></td></tr>
 <?php } ?>
 <?php } ?>
+      <tr><th>Whole Genome Viewer</th><td><?php print ($node->cvitjs_enabled) ? 'Enabled' : 'Disabled'; ?></td></tr>
     </table>
     </table>
 
 
+
+    <?php
+      if ($node->cvitjs_enabled) {
+
+        print '<h3>Whole Genome Viewer</h3>';
+
+        $conf_section = blast_ui_get_cvit_conf_text('data.'.$node->db_name);
+
+        if (!$conf_section) {
+
+          print '<div class="messages warning">There is no section for this genome target defined in the CViTjs
+            configuration file. <strong>No genome visualization will be shown until you define a
+            configuration section, "[data.'.$form_state['values']['db_name'].']", at '
+            .l('Admin > Tripal > Extensions > Tripal BLAST > BLAST UI', 'admin/tripal/extension/tripal_blast')
+            .'</strong>.</div>';
+        }
+        else {
+          print '<h4>Configuration</h4>'
+            . '<pre>'.$conf_section.'</pre>';
+        }
+    }
+    ?>
     <?php
     <?php
       // Add in any remaining content
       // Add in any remaining content
       print render($content);
       print render($content);