|
@@ -29,13 +29,13 @@ function blast_protein_form($form, &$form_state) {
|
|
'#collapsible' => TRUE,
|
|
'#collapsible' => TRUE,
|
|
'#collapsed' => FALSE,
|
|
'#collapsed' => FALSE,
|
|
'#prefix' => '<div class="two-col">',
|
|
'#prefix' => '<div class="two-col">',
|
|
- '#suffix' => '</div>',
|
|
|
|
|
|
+ '#suffix' => '</div>',
|
|
);
|
|
);
|
|
$form['query']['example_sequence'] = array(
|
|
$form['query']['example_sequence'] = array(
|
|
- '#type' => 'button',
|
|
|
|
|
|
+ '#type' => 'button',
|
|
'#button_type'=> 'button',
|
|
'#button_type'=> 'button',
|
|
'#limit_validation_errors' => array(),
|
|
'#limit_validation_errors' => array(),
|
|
- '#value' => t('Example Sequence'),
|
|
|
|
|
|
+ '#value' => t('Example Sequence'),
|
|
'#prefix' => '<div class="center">',
|
|
'#prefix' => '<div class="center">',
|
|
'#suffix' => '</div>',
|
|
'#suffix' => '</div>',
|
|
'#validate' => array(),
|
|
'#validate' => array(),
|
|
@@ -64,13 +64,13 @@ function blast_protein_form($form, &$form_state) {
|
|
'#type' => 'file',
|
|
'#type' => 'file',
|
|
'#description' => t('The file should be a plain-text FASTA file and not a .doc, .docx, etc. It cannot be greater than 10 Mb in size.'),
|
|
'#description' => t('The file should be a plain-text FASTA file and not a .doc, .docx, etc. It cannot be greater than 10 Mb in size.'),
|
|
);
|
|
);
|
|
-
|
|
|
|
-
|
|
|
|
|
|
+
|
|
|
|
+
|
|
$form['query']['example_sequence'] = array(
|
|
$form['query']['example_sequence'] = array(
|
|
- '#type' => 'button',
|
|
|
|
|
|
+ '#type' => 'button',
|
|
'#button_type'=> 'button',
|
|
'#button_type'=> 'button',
|
|
'#limit_validation_errors' => array(),
|
|
'#limit_validation_errors' => array(),
|
|
- '#value' => t('Example Sequence'),
|
|
|
|
|
|
+ '#value' => t('Example Sequence'),
|
|
'#prefix' => '<div class="center">',
|
|
'#prefix' => '<div class="center">',
|
|
'#suffix' => '</div>',
|
|
'#suffix' => '</div>',
|
|
'#validate' => array(),
|
|
'#validate' => array(),
|
|
@@ -672,7 +672,7 @@ function blast_protein_form_submit($form, &$form_state) {
|
|
if ( isset($form_state['qFlag']) ) {
|
|
if ( isset($form_state['qFlag']) ) {
|
|
if ( $form_state['qFlag'] == 'seqQuery' ) {
|
|
if ( $form_state['qFlag'] == 'seqQuery' ) {
|
|
$seq_content = $form_state['values']['FASTA'];
|
|
$seq_content = $form_state['values']['FASTA'];
|
|
- $query = "/tmp/user__query_file.fasta";
|
|
|
|
|
|
+ $query = '/tmp/' . date('YMd_His') . '_query.fasta';
|
|
file_put_contents ( $query , $seq_content);
|
|
file_put_contents ( $query , $seq_content);
|
|
}
|
|
}
|
|
elseif ( $form_state['qFlag'] == 'upQuery' ) {
|
|
elseif ( $form_state['qFlag'] == 'upQuery' ) {
|
|
@@ -904,8 +904,8 @@ function ajax_example_dependent_dropdown_callback($form, $form_state) {
|
|
// call back function for example sequence
|
|
// call back function for example sequence
|
|
function ajax_protein_text_area_callback($form, $form_state) {
|
|
function ajax_protein_text_area_callback($form, $form_state) {
|
|
$element = $form['query']['FASTA']; // Get example Protein sequence
|
|
$element = $form['query']['FASTA']; // Get example Protein sequence
|
|
-
|
|
|
|
-$element['#value'] =
|
|
|
|
|
|
+
|
|
|
|
+$element['#value'] =
|
|
'>gi|166477|gb|AAA96434.1| resveratrol synthase [Arachis hypogaea]
|
|
'>gi|166477|gb|AAA96434.1| resveratrol synthase [Arachis hypogaea]
|
|
MVSVSGIRKVQRAEGPATVLAIGTANPPNCIDQSTYADYYFRVTNSEHMTDLKKKFQRICERTQIKNRHM
|
|
MVSVSGIRKVQRAEGPATVLAIGTANPPNCIDQSTYADYYFRVTNSEHMTDLKKKFQRICERTQIKNRHM
|
|
YLTEEILKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGV
|
|
YLTEEILKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGV
|