<?php /** * @file * The main file for the blast UI module. */ // BLAST Submission Forms require_once 'includes/blast_ui.form_common.inc'; require_once 'includes/blast_ui.form_advanced_options.inc'; // NOTE: The forms themeselves are included using hook_menu to ensure they // are only inlcuded when needed. // BLAST DB Node functionality require_once 'includes/blast_ui.node.inc'; // Functions specific to themeing (ie: preprocess) require_once 'theme/blast_ui.theme.inc'; // Application Programmers Interface require_once 'api/blast_ui.api.inc'; // Administration require_once 'includes/blast_ui.admin.inc'; /** * Implements hook_menu(). */ function blast_ui_menu() { // BLAST DB Node $items['node__blastdb'] = array( 'template' => 'node--blastdb', 'render element' => 'node', 'base hook' => 'node', 'path' => 'theme', ); // Single All-in-One BLAST submission form $items['blast'] = array( 'title' => 'BLAST', 'page callback' => 'drupal_get_form', 'page arguments' => array('blast_ui_all_in_one_form'), 'access arguments' => array('access content'), 'file' => 'includes/blast_ui.form_single.inc', 'type' => MENU_NORMAL_ITEM, 'expanded' => TRUE, ); // Per Query Type BLAST submission forms $items['blast/nucleotide'] = array( 'title' => 'Nucleotide Query', 'page callback' => 'drupal_get_form', 'page arguments' => array('blast_ui_per_query_type_form', 1, 2), 'access arguments' => array('access content'), 'file' => 'includes/blast_ui.form_per_query_type.inc', 'type' => MENU_NORMAL_ITEM, 'expanded' => TRUE, ); $items['blast/protein'] = array( 'title' => 'Protein Query', 'page callback' => 'drupal_get_form', 'page arguments' => array('blast_ui_per_query_type_form', 1), 'access arguments' => array('access content'), 'file' => 'includes/blast_ui.form_per_query_type.inc', 'type' => MENU_NORMAL_ITEM, 'expanded' => TRUE, ); // Per BLAST-program submission forms $items['blast/nucleotide/nucleotide'] = array( 'title' => 'BLASTn', 'page callback' => 'drupal_get_form', 'page arguments' => array('blast_ui_per_blast_program_form', 1, 2), 'access arguments' => array('access content'), 'file' => 'includes/blast_ui.form_per_program.inc', 'type' => MENU_NORMAL_ITEM ); $items['blast/nucleotide/protein'] = array( 'title' => 'BLASTx', 'page callback' => 'drupal_get_form', 'page arguments' => array('blast_ui_per_blast_program_form', 1, 2), 'access arguments' => array('access content'), 'file' => 'includes/blast_ui.form_per_program.inc', 'type' => MENU_NORMAL_ITEM ); $items['blast/protein/nucleotide'] = array( 'title' => 'tBLASTn', 'page callback' => 'drupal_get_form', 'page arguments' => array('blast_ui_per_blast_program_form', 1, 2), 'access arguments' => array('access content'), 'file' => 'includes/blast_ui.form_per_program.inc', 'type' => MENU_NORMAL_ITEM ); $items['blast/protein/protein'] = array( 'title' => 'BLASTp', 'page callback' => 'drupal_get_form', 'page arguments' => array('blast_ui_per_blast_program_form', 1, 2), 'access arguments' => array('access content'), 'file' => 'includes/blast_ui.form_per_program.inc', 'type' => MENU_NORMAL_ITEM ); // BLAST Results page $items['blast/report/%'] = array( 'title' => 'BLAST Results', 'page callback' => 'show_blast_output', 'page arguments' => array(2), 'access arguments' => array('access content'), 'type' => MENU_CALLBACK, ); // BLAST Admin $items['admin/tripal/extension/blast_ui'] = array( 'title' => 'BLAST User Interface', 'description' => 'Provides an interface allowing users to execute their own BLASTs.', 'page callback' => 'drupal_get_form', 'page arguments' => array('blast_ui_admin_form'), 'access arguments' => array('administer tripal'), 'type' => MENU_NORMAL_ITEM, ); return $items; } /** * Implements hook_theme(). */ function blast_ui_theme() { $items = array(); $path = drupal_get_path('module', 'blast_ui'); // Displays the BLAST results for each job $items['show_blast_report'] = array( 'template' => 'blast_report', 'path' => "$path/theme", ); // Displays the BLAST results for each job $items['blast_report_pending'] = array( 'template' => 'blast_report_pending', 'path' => "$path/theme", ); // Themes the alignments in a BLAST result display $items['blast_report_alignment_row'] = array( 'template' => 'blast_report_alignment_row', 'variables' => array('hsps' => NULL), 'path' => "$path/theme", ); // Menu Information Pages // These are only seen if the user has disabled the all-in-one // or by query type forms. $items['blast_user_menupage'] = array( 'template' => 'blast_user_menupage', 'path' => "$path/theme", ); $items['blast_nucleotide_user_menupage'] = array( 'template' => 'blast_nucleotide_user_menupage', 'path' => "$path/theme", ); $items['blast_protein_user_menupage'] = array( 'template' => 'blast_protein_user_menupage', 'path' => "$path/theme", ); return $items; } /** * Facilitate presenting the result of the blast search * * @param $job_id * The tripal job_id of the BLAST job previously submitted * * @return $result * Return HTML output of the BLAST results to be displayed to the user * */ function show_blast_output($job_id) { // BLASTs are run as a Tripal job. As such we need to determine whether the current // BLAST is in the queue, running or complete in order to determine what to show the user $job = tripal_get_job($job_id); // 1) Job is in the Queue if ($job->start_time === NULL AND $job->end_time == NULL) { return theme('blast_report_pending', array('status_code' => 0, 'status' => 'Pending')); } // 2) Job has been Cancelled elseif ($job->status == 'Cancelled') { return theme('blast_report_pending', array('status_code' => 999, 'status' => 'Cancelled')); } // 3) Job is Complete elseif ($job->end_time !== NULL) { // Return the Results :) return theme('show_blast_report', array('job_id' => $job_id)); } // 4) Job is in Progress else { return theme('blast_report_pending', array('status_code' => 1, 'status' => 'Running')); } return ''; } /** * */ function ajax_blast_ui_example_sequence_callback($form, $form_state) { // First, set a default example sequence in case administrators have not yet // bothered to set their own. $sequence_type = $form_state['values']['query_type']; if ($sequence_type == 'nucleotide') { $default_example_sequence = '>partial lipoxygenase Glyma15g03040 TTTCGTATGA GATTAAAATG TGTGAAATTT TGTTTGATAG GACATGGGAA AGGAAAAGTT GGAAAGGCTA CAAATTTAAG AGGACAAGTG TCGTTACCAA CCTTGGGAGC TGGCGAAGAT GCATACGATG TTCATTTTGA ATGGGACAGT GACTTCGGAA TTCCCGGTGC ATTTTACATT AAGAACTTCA TGCAAGTTGA GTTCTATCTC AAGTCTCTAA CTCTCGAAGA CATTCCAAAC CACGGAACCA TTCACTTCGT ATGCAACTCC TGGGTTTACA ACTCAAAATC CTACCATTCT GATCGCATTT TCTTTGCCAA CAATGTAAGC TACTTAAATA CTGTTATACA TTGTCTAACA TCTTGTTAGA GTCTTGCATG ATGTGTACCG TTTATTGTTG TTGTTGAACT TTACCACATG GCATGGATGC AAAAGTTGTT ATACACATAA ATTATAATGC AGACATATCT TCCAAGCGAG ACACCGGCTC CACTTGTCAA GTACAGAGAA GAAGAATTGA AGAATGTAAG AGGGGATGGA ACTGGTGAGC GCAAGGAATG GGATAGGATC TATGATTATG ATGTCTACAA TGACTTGGGC GATCCAGATA AGGGTGAAAA GTATGCACGC CCCGTTCTTG GAGGTTCTGC CTTACCTTAC CCTCGCAGAG GAAGAACCGG AAGAGGAAAA ACTAGAAAAG GTTTCTCACT AGTCACTAAT TTATTACTTT TTAATGTTTG TTTTTAGGCA TCTTTTCTGA TGAAATGTAT ACTTTTGATG TTTTTTTGTT TTAGCATAAC TGAATTAGTA AAGTGTGTTG TGTTCCTTAG AAGTTAGAAA AGTACTAAGT ATAAGGTCTT TGAGTTGTCG TCTTTATCTT AACAGATCCC AACAGTGAGA AGCCCAGTGA TTTTGTTTAC CTTCCGAGAG ATGAAGCATT TGGTCACTTG AAGTCATCAG ATTTTCTCGT TTATGGAATC AAATCAGTGG CTCAAGACGT CTTGCCCGTG TTGACTGATG CGTTTGATGG CAATCTTTTG AGCCTTGAGT TTGATAACTT TGCTGAAGTG CGCAAACTCT ATGAAGGTGG AGTTACACTA CCTACAAACT TTCTTAGCAA GATCGCCCCT ATACCAGTGG TCAAGGAAAT TTTTCGAACT GATGGCGAAC AGTTCCTCAA GTATCCACCA CCTAAAGTGA TGCAGGGTAT GCTACATATT TTGAATATGT AGAATATTAT CAATATACTC CTGTTTTTAT TCAACATATT TAATCACATG GATGAATTTT TGAACTGTTA'; } elseif ($sequence_type == 'protein') { $default_example_sequence = '>gi|166477|gb|AAA96434.1| resveratrol synthase [Arachis hypogaea] MVSVSGIRKVQRAEGPATVLAIGTANPPNCIDQSTYADYYFRVTNSEHMTDLKKKFQRICERTQIKNRHM YLTEEILKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGV DYELIVLLGLDPCVKRYMMYHQGCFAGGTVLRLAKDLAENNKDARVLIVCSENTAVTFRGPSETDMDSLV GQALFADGAAAIIIGSDPVPEVEKPIFELVSTDQKLVPGSHGAIGGLLREVGLTFYLNKSVPDIISQNIN DALNKAFDPLGISDYNSIFWIAHPGGRAILDQVEQKVNLKPEKMKATRDVLSNYGNMSSACVFFIMDLMR KRSLEEGLKTTGEGLDWGVLFGFGPGLTIETVVLRSVAI'; } else { $default_example_sequence = ''; } // If the Show Example checkbox is true then put the example in the textfield if ($form_state['values']['example_sequence']) { // Set the value to be the example sequence (either set by the administrator // or the default set above). $form['query']['FASTA']['#value'] = variable_get( 'blast_ui_' . $sequence_type . '_example_sequence', $default_example_sequence ); } // Otherwise we want to remove the already displayed example. else { $form['query']['FASTA']['#value'] = ''; } return $form['query']['FASTA']; }