'fieldset', '#title' => 'General' ); $form['general']['blast_path']= array( '#type' => 'textfield', '#title' => t('Enter the path of the BLAST program'), '#description' => t('You can ignore if your $PATH variable is set. Otherwise, enter the absoulte path to bin folder. For example, /opt/blast/2.2.29+/bin/'), '#default_value' => variable_get('blast_path', ''), ); $form['general']['blast_threads']= array( '#type' => 'textfield', '#title' => t('Enter the number of CPU threads to use in blast search.'), '#description' => t('You can increase the number to reduce the search time. Before you increase, please check your hardware configurations . A value of one(1) can result in a slower search for some programs eg. tblastn.'), '#default_value' => variable_get('blast_threads', 1), ); $form['general']['eVal']= array( '#type' => 'textfield', '#title' => t('e-Value (Expected Threshold)'), '#description' => t('Expected number of chance matches in a random model. This number should be give in a decimal format.'), '#default_value' => variable_get('eVal', 0.001), //'#default_value' => variable_get('blast_threads', 1), ); $form['general']['qRange']= array( '#type' => 'textfield', '#title' => t('Max matches in a query range'), '#description' => t('Limit the number of matches to a query range. This option is useful if many strong matches to one part of a query may prevent BLAST from presenting weaker matches to another part of the query.'), '#default_value' => variable_get('qRange', 0), ); $form['file_upload'] = array( '#type' => 'fieldset', '#title' => 'Allow File Upload', '#description' => 'The following options allow you to control whether your users can upload files for the query or target respectively. The ability to upload files allows them to more conviently BLAST large sets of sequences. However, the size of the files could be problematic, storage-wise, on your server.
' ); $form['file_upload']['query_upload'] = array( '#type' => 'checkbox', '#title' => 'Enable Query Sequence Upload', '#description' => 'When checked, a query file upload field will be available on BLAST request forms.', '#default_value' => FALSE, '#default_value' => variable_get('blast_ui_allow_query_upload', TRUE) ); $form['file_upload']['target_upload'] = array( '#type' => 'checkbox', '#title' => 'Enable Target Sequence Upload', '#description' => 'When checked, a target file upload field will be available on BLAST request forms.', '#default_value' => FALSE, '#default_value' => variable_get('blast_ui_allow_target_upload', FALSE) ); $form['example_sequence'] = array( '#type' => 'fieldset', '#title' => 'Set Example Sequences', '#description' => 'There is the ability to show example sequences built-in to the various BLAST forms. Use the following fields to set these example sequences. This allows you to provide more relevant examples to your users.' ); $nucleotide_default = '>partial lipoxygenase Glyma15g03040 TTTCGTATGA GATTAAAATG TGTGAAATTT TGTTTGATAG GACATGGGAA AGGAAAAGTT GGAAAGGCTA CAAATTTAAG AGGACAAGTG TCGTTACCAA CCTTGGGAGC TGGCGAAGAT GCATACGATG TTCATTTTGA ATGGGACAGT GACTTCGGAA TTCCCGGTGC ATTTTACATT AAGAACTTCA TGCAAGTTGA GTTCTATCTC AAGTCTCTAA CTCTCGAAGA CATTCCAAAC CACGGAACCA TTCACTTCGT ATGCAACTCC TGGGTTTACA ACTCAAAATC CTACCATTCT GATCGCATTT TCTTTGCCAA CAATGTAAGC TACTTAAATA CTGTTATACA TTGTCTAACA TCTTGTTAGA GTCTTGCATG ATGTGTACCG TTTATTGTTG TTGTTGAACT TTACCACATG GCATGGATGC AAAAGTTGTT ATACACATAA ATTATAATGC AGACATATCT TCCAAGCGAG ACACCGGCTC CACTTGTCAA GTACAGAGAA GAAGAATTGA AGAATGTAAG AGGGGATGGA ACTGGTGAGC GCAAGGAATG GGATAGGATC TATGATTATG ATGTCTACAA TGACTTGGGC GATCCAGATA AGGGTGAAAA GTATGCACGC CCCGTTCTTG GAGGTTCTGC CTTACCTTAC CCTCGCAGAG GAAGAACCGG AAGAGGAAAA ACTAGAAAAG GTTTCTCACT AGTCACTAAT TTATTACTTT TTAATGTTTG TTTTTAGGCA TCTTTTCTGA TGAAATGTAT ACTTTTGATG TTTTTTTGTT TTAGCATAAC TGAATTAGTA AAGTGTGTTG TGTTCCTTAG AAGTTAGAAA AGTACTAAGT ATAAGGTCTT TGAGTTGTCG TCTTTATCTT AACAGATCCC AACAGTGAGA AGCCCAGTGA TTTTGTTTAC CTTCCGAGAG ATGAAGCATT TGGTCACTTG AAGTCATCAG ATTTTCTCGT TTATGGAATC AAATCAGTGG CTCAAGACGT CTTGCCCGTG TTGACTGATG CGTTTGATGG CAATCTTTTG AGCCTTGAGT TTGATAACTT TGCTGAAGTG CGCAAACTCT ATGAAGGTGG AGTTACACTA CCTACAAACT TTCTTAGCAA GATCGCCCCT ATACCAGTGG TCAAGGAAAT TTTTCGAACT GATGGCGAAC AGTTCCTCAA GTATCCACCA CCTAAAGTGA TGCAGGGTAT GCTACATATT TTGAATATGT AGAATATTAT CAATATACTC CTGTTTTTAT TCAACATATT TAATCACATG GATGAATTTT TGAACTGTTA'; $form['example_sequence']['nucleotide_example'] = array( '#type' => 'textarea', '#title' => 'Nucleotide Example', '#description' => t('Enter a complete nucleotide FASTA record including the header. More information: FASTA format.', array('@fasta-format-url' => 'http://www.ncbi.nlm.nih.gov/BLAST/blastcgihelp.shtml')), '#default_value' => variable_get( 'blast_ui_nucleotide_example_sequence', $nucleotide_default ) ); $protein_default = '>gi|166477|gb|AAA96434.1| resveratrol synthase [Arachis hypogaea] MVSVSGIRKVQRAEGPATVLAIGTANPPNCIDQSTYADYYFRVTNSEHMTDLKKKFQRICERTQIKNRHM YLTEEILKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGV DYELIVLLGLDPCVKRYMMYHQGCFAGGTVLRLAKDLAENNKDARVLIVCSENTAVTFRGPSETDMDSLV GQALFADGAAAIIIGSDPVPEVEKPIFELVSTDQKLVPGSHGAIGGLLREVGLTFYLNKSVPDIISQNIN DALNKAFDPLGISDYNSIFWIAHPGGRAILDQVEQKVNLKPEKMKATRDVLSNYGNMSSACVFFIMDLMR KRSLEEGLKTTGEGLDWGVLFGFGPGLTIETVVLRSVAI'; $form['example_sequence']['protein_example'] = array( '#type' => 'textarea', '#title' => 'Protein Example', '#description' => t('Enter a complete protein FASTA record including the header. More information: FASTA format.', array('@fasta-format-url' => 'http://www.ncbi.nlm.nih.gov/BLAST/blastcgihelp.shtml')), '#default_value' => variable_get( 'blast_ui_protein_example_sequence', $protein_default ) ); $form['submit'] = array( '#type' => 'submit', '#value' => 'Save Configuration' ); return $form; } /** * Validate the Admin/Settings form. */ function blast_ui_admin_form_validate($form, &$form_state) { $blast_path = $form_state['values']['blast_path']; $blast_path .= 'blastn'; if(!empty($blast_path)) { if(file_exists($blast_path) ) { variable_set('blast_path', $form_state['values']['blast_path']); } else { form_set_error('blast_path', t('Please enter a valid path or you can leave it blank')); } } } /** * Submit the Admin/settings form. */ function blast_ui_admin_form_submit($form, $form_state) { variable_set('blast_path', $form_state['values']['blast_path']); variable_set('blast_threads', $form_state['values']['blast_threads']); variable_set('eVal', $form_state['values']['eVal']); variable_set('qRange', $form_state['values']['qRange']); variable_set('blast_ui_allow_query_upload', $form_state['values']['query_upload']); variable_set('blast_ui_allow_target_upload', $form_state['values']['target_upload']); variable_set('blast_ui_nucleotide_example_sequence', $form_state['values']['nucleotide_example']); variable_set('blast_ui_protein_example_sequence', $form_state['values']['protein_example']); }