123456789101112131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899100101102103104105106107108109110111112113114115116117118119120121122123124125126127128129130131132133134135136137138139140141142143144145146147148149150151152153154155156157158159160161162163164165166167168169170171172173174175176177178179180181182183184185186187188189190191192193194195196197198199200201202203204205206207208209210211212213214215216217218219220221222223224225226227228229230231232233234235236237238239240241242243244245246247248249250251252253254255256257258259260261262263264265266267268269270271272273274275276277278279280281282283284285286287288289290291292293294295296297298299300301302303304305306307308309310311312313314315316317318319320321322323324325326327328329330331332333334335336337338339340341342343344345346347348349350351352353354355356357358359360361362363364365366367368369370371372373374375376377378379380381382383384385386387388389390391392393394395396397398399400401402403404405406407408409410411412413414415416417418419420421422423424425426427428429430431432433434435436437438439440441442443444445446447448449450451452453454455456457458459460461462463464465466467468469470471472473474475476477478479480481482483484485486487488489490491492493494495496497498499500501502503504505506507508509510511512513514515516517518519520521522523524525526527528529530531532533534535536537538539540541542543544545546547548549550551552553554555556557558559560561562563564565566567568569570571572573574575576577578579580581582583584585586587588589590591592593594595596597598599600601602603604605606607608609610611612613614615616617618619620621622623624625626627628629630631632633634635636637638639640641642643644645646647648649650651652653654655656657658659660661662663664665666667668669670671672673674675676677678679680681682683684685686687688689690691692693694695696697698699700701702703704705706707708709710711712713714715716717718719720721722723724725726727728729730731732733734735736737738739740741742743744745746747748749750751752753754755756757758759760761762763764765766767768769770771772773774775776777778779780781782783784785786787788789790791792793794795796797798799800801802803804805806807808809810811812813814815816817818819820821822823824825826827828829830831832833834835836837838839840841842843844845846847848849850851852853854855856857858859860861862863864865866867868869870871872873874875876877878879880881882883884885886887888889890891892893894895896897898899900901902903904905906907908909910911912913914915916917918919920921922923924925926927928929930931932933934935 |
- <?php
- /**
- * @file
- * Contains all functions for the Protein BLAST
- */
- /**
- * Protein BLAST Submission Form
- *
- * @see blast_protein_form_validate()
- * @see blast_protein_form_submit()
- */
- function blast_protein_form($form, &$form_state) {
- // CSS support to the form
- $form['#attached']['css'] = array(
- drupal_get_path('module', 'blast_ui') . '/css/form.css',
- );
- // PROTEIN QUERY
- //.........................
- $form['query'] = array(
- '#type' => 'fieldset',
- '#title' => t('Enter Query Sequence'),
- '#description' => t('Enter one or more queries in the top text box or use the browse button to upload a file from your local disk. The file may contain a single sequence or a list of sequences. In both cases, the data must be in FASTA format. <a href="http://www.ncbi.nlm.nih.gov/BLAST/blastcgihelp.shtml" target="_blank">More information..</a> '),
- '#collapsible' => TRUE,
- '#collapsed' => FALSE,
- '#prefix' => '<div class="two-col">',
- '#suffix' => '</div>',
- );
- $form['query']['example_sequence'] = array(
- '#type' => 'button',
- '#button_type'=> 'button',
- '#limit_validation_errors' => array(),
- '#value' => t('Example Sequence'),
- '#prefix' => '<div class="center">',
- '#suffix' => '</div>',
- '#validate' => array(),
- '#ajax' => array(
- 'callback' => 'ajax_nucleotide_text_area_callback',
- 'wrapper' => 'fasta_seq',
- 'method' => 'replace',
- 'effect' => 'fade',
- ),
- '#attributes' => array('onclick' => 'return false;'),
- );
- $form['query']['FASTA'] = array(
- '#type' => 'textarea',
- '#title' => t('Enter FASTA sequence(s)'),
- '#description'=>t('Enter query sequence(s) in the text area.'),
- '#prefix' => '<div id="fasta_seq">',
- '#suffix' => '</div>',
- );
- // Upload a file as an alternative to enter a query sequence
- $form['#attributes']['enctype'] = 'multipart/form-data';
- $form['query']['UPLOAD'] = array(
- '#prefix' => 'Or upload your query files: ',
- '#type' => 'file',
- '#description' => t('The file should be a plain-text FASTA file and not a .doc, .docx, etc. It cannot be greater than 10 Mb in size.'),
- );
- $form['query']['example_sequence'] = array(
- '#type' => 'button',
- '#button_type'=> 'button',
- '#limit_validation_errors' => array(),
- '#value' => t('Example Sequence'),
- '#prefix' => '<div class="center">',
- '#suffix' => '</div>',
- '#validate' => array(),
- '#ajax' => array(
- 'callback' => 'ajax_protein_text_area_callback',
- 'wrapper' => 'fasta_seq',
- 'method' => 'replace',
- 'effect' => 'fade',
- ),
- '#attributes' => array('onclick' => 'return false;'),
- );
- // BLAST DATABASE
- //.........................
- $form['DB'] = array(
- '#type' => 'fieldset',
- '#title' => t('Choose Search Set'),
- '#description' => t('Choose from one of the protein BLAST databases listed below. You can also use the browse button to upload a file from your local disk. The file may contain a single sequence or a list of sequences. '),
- '#collapsible' => TRUE,
- '#collapsed' => FALSE,
- );
- $options = get_blast_database_options('p');
- $form['DB']['SELECT_DB'] = array(
- '#type' => 'select',
- '#title' => t('Protein BLAST Databases:'),
- '#options' => $options,
- '#default_value' => t('Select a database'),
- );
- // Upload a file as an alternative to enter a query sequence
- $form['#attributes']['enctype'] = 'multipart/form-data';
- $form['DB']['DBUPLOAD'] = array(
- '#prefix' => 'Or upload your own dataset: ',
- '#type' => 'file',
- '#description' => t('The file should be a plain-text FASTA file and not a .doc, .docx, etc. It cannot be greater than 10 Mb in size.'),
- );
- // ALGORITHM PARAMETERS
- //.........................
- $form['ALG'] = array(
- '#type' => 'fieldset',
- '#title' => t('Algorithm parameters'),
- '#collapsible' => TRUE,
- '#collapsed' => TRUE,
- );
- //General parameters
- $form['ALG']['GParam'] = array(
- '#type' => 'fieldset',
- '#title' => t('General parameters'),
- '#collapsible' => FALSE,
- );
- $form['ALG']['GParam']['maxTarget'] = array(
- '#type' => 'select',
- '#title' => t('Max target sequences:'),
- '#options' => array(
- 0 => t('10'),
- 1 => t('50'),
- 2 => t('100'),
- 3 => t('250'),
- 4 => t('500'),
- 5 => t('1000'),
- 6 => t('5000'),
- 7 => t('10000'),
- 8 => t('20000'),
- ),
- '#default_value' => 2,
- '#description' => t('Select the maximum number of aligned sequences to display'),
- );
- $form['ALG']['GParam']['shortQueries'] = array(
- '#type' => 'checkbox',
- '#title' => t('Automatically adjust parameters for short input sequences'),
- '#default_value' => TRUE,
- );
- $form['ALG']['GParam']['eVal'] = array(
- '#type' => 'textfield',
- '#title' => t('e-value(Expect threshold)'),
- '#default_value' => 10,
- '#size' => 12,
- '#maxlength' => 20,
- '#description' => t('Expected number of chance matches in a random model.'),
- );
- $form['ALG']['GParam']['wordSize'] = array(
- '#type' => 'select',
- '#title' => t('Word size:'),
- '#options' => array(
- 0 => t('2'),
- 1 => t('3'),
- ),
- '#default_value' => 1,
- '#description' => t('The length of the seed that initiates an alignment'),
- );
- $form['ALG']['GParam']['qRange'] = array(
- '#type' => 'textfield',
- '#title' => t('Max matches in a query range'),
- '#default_value' => 0,
- '#size' => 12,
- '#maxlength' => 20,
- '#description' => t('Limit the number of matches to a query range. This option is useful if many strong matches to one part of a query may prevent BLAST from presenting weaker matches to another part of the query.'),
- );
- // Scoring parameters
- $form['ALG']['SParam'] = array(
- '#type' => 'fieldset',
- '#title' => t('Scoring parameters'),
- '#collapsible' => FALSE,
- );
- $options_first = _ajax_example_get_first_dropdown_options();
- $selected = isset($form_state['values']['MATRIX'] ) ? $form_state['values']['MATRIX'] : key($options_first);
- $form['ALG']['SParam']['MATRIX'] = array(
- '#type' => 'select',
- '#title' => 'Matrix',
- '#options' => $options_first,
- '#default_value' => $selected,
- '#description' => t('Assigns a score for aligning pairs of residues, and determines overall alignment score..'),
- '#ajax' => array(
- 'callback' => 'ajax_example_dependent_dropdown_callback',
- 'wrapper' => 'dropdown-second-replace',
- ),
- );
- $form['ALG']['SParam']['gapCost'] = array(
- '#type' => 'select',
- '#title' => t('Gap Costs:'),
- '#prefix' => '<div id="dropdown-second-replace">',
- '#suffix' => '</div>',
- '#options' => _ajax_example_get_second_dropdown_options($selected),
- '#default_value' => 2,
- '#description' => t('Cost to create and extend a gap in an alignment.'),
- );
- $form['ALG']['SParam']['M&MScores'] = array(
- '#type' => 'select',
- '#title' => t('Match/Mismatch Scores:'),
- '#options' => array(
- 0 => t('No adjustment'),
- 1 => t('Composition-based statistics'),
- 2 => t('Conditional compositional score matrix adjustment'),
- 3 => t('Universal composition score matrix adjustment '),
- ),
- '#default_value' => 2,
- '#description' => t('Matrix adjustment method to compensate for amino acid composition of sequences'),
- );
- //Submit
- $form['submit'] = array(
- '#type' => 'submit',
- '#default_value' => ' BLAST ',
- );
- return $form;
- }
- /**
- * Form validation handler for blast_protein_form().
- *
- * @see blast_protein_form_validate()
- */
- function blast_protein_form_validate($form, &$form_state) {
- // Get the sequence
- $fastaSeq = $form_state['values']['FASTA'];
- $upQuery = file_save_upload('UPLOAD', array('file_validate_extensions' => array('txt fasta fa fna'),
- ), FILE_EXISTS_RENAME);
- // Check if the sequence is empty
- if(empty($fastaSeq) && empty($upQuery)) {
- form_set_error('query', t('No query sequence given. Only raw sequence or sequence of type FASTA can be read.
- Enter sequence in the box provided or upload a plain text file.'));
- }
-
- // Get the DB
- $db_selected = $form_state['values']['SELECT_DB'];
- $upDB = file_save_upload('DB', array('file_validate_extensions' => array('txt fasta fa fna'),
- ), FILE_EXISTS_RENAME);
- // Check if the database is selected or not
- if(empty($upDB) && $db_selected == 0) {
- form_set_error('DB', t('Select the database from the list or upload the FASTA file'));
- }
-
- // Validate query sequence
- if (isset($fastaSeq)) {
- if (validateFasta($fastaSeq)){
- form_set_error('FASTA', t('Error: Failed to read the Blast query: Wrong format provided for FASTA protein sequence'));
- }
- else {
- $form_state['qFlag'] = 'seqQuery';
- }
- }
- // Validate Query Upload
- if ($upQuery) {
- $upQuery_uri = $upQuery->uri;
- $form_state['upQuery_path'] = drupal_realpath($upQuery_uri);
- $upQuery_content = file_get_contents($form_state['upQuery_path']);
- if(validateFasta($upQuery_content)){
- form_set_error('UPLOAD', t('Error: Failed to upload the Blast query: Wrong format provided for FASTA protein sequence'));
- }
- else {
- $form_state['qFlag'] = 'upQuery';
- }
- }
- // Validate uploaded database
- if ($upDB) {
- $upDB_uri = $upDB->uri;
- $form_state['upDB_path'] = drupal_realpath($upDB_uri);
- $upDB_content = file_get_contents($form_state['upDB_path']);
- if(validateFasta($upDB_content)){
- form_set_error('SELECT_DB', t('Error: Failed to upload the Blast subject sequence file: Wrong format provided for FASTA protein sequence'));
- }
- else {
- $form_state['dbFlag'] = 'upQuery';
- }
- }
- else {
- $form_state['dbFlag'] = 'blastdb';
- }
- }
- /**
- * Form submition handler for blast_protein_form().
- *
- * @see blast_protein_form_submit()
- */
- function blast_protein_form_submit($form, &$form_state) {
- $eVal = $form_state['values']['eVal'];
- $trgtKey = $form_state['values']['maxTarget'];
- $numAlign = $form['ALG']['GParam']['maxTarget']['#options'][$trgtKey];
- $wsKey = $form_state['values']['wordSize'];
- $wordSize = $form['ALG']['GParam']['wordSize']['#options'][$wsKey];
- // Expand Gap Cost key into open and extend penalties
- $gapKey = $form_state['values']['MATRIX'];
- switch ($gapKey) {
- case 0:
- $matrix ="PAM30";
- $gapKey = $form_state['values']['gapCost'];
- switch ($gapKey) {
- case 0:
- $gapOpen = 7;
- $gapExtend = 2;
- break;
- case 1:
- $gapOpen = 6;
- $gapExtend = 2;
- break;
- case 2:
- $gapOpen = 5;
- $gapExtend = 2;
- break;
- case 3:
- $gapOpen = 10;
- $gapExtend = 1;
- break;
- case 4:
- $gapOpen = 9;
- $gapExtend = 1;
- break;
- case 5:
- $gapOpen = 8;
- $gapExtend = 1;
- break;
- }
- break;
- case 1:
- $matrix ="PAM70";
- $gapKey = $form_state['values']['gapCost'];
- switch ($gapKey) {
- case 0:
- $gapOpen = 8;
- $gapExtend = 2;
- break;
- case 1:
- $gapOpen = 7;
- $gapExtend = 2;
- break;
- case 2:
- $gapOpen = 6;
- $gapExtend = 2;
- break;
- case 3:
- $gapOpen = 11;
- $gapExtend = 1;
- break;
- case 4:
- $gapOpen = 10;
- $gapExtend = 1;
- break;
- case 5:
- $gapOpen = 9;
- $gapExtend = 1;
- break;
- }
- break;
- case 2:
- $matrix ="PAM250";
- $gapKey = $form_state['values']['gapCost'];
- switch ($gapKey) {
- case 0:
- $gapOpen = 15;
- $gapExtend = 3;
- break;
- case 1:
- $gapOpen = 14;
- $gapExtend = 3;
- break;
- case 2:
- $gapOpen = 13;
- $gapExtend = 3;
- break;
- case 3:
- $gapOpen = 12;
- $gapExtend = 3;
- break;
- case 4:
- $gapOpen = 11;
- $gapExtend = 3;
- break;
- case 5:
- $gapOpen = 17;
- $gapExtend = 2;
- break;
- case 6:
- $gapOpen = 16;
- $gapExtend = 2;
- break;
- case 7:
- $gapOpen = 15;
- $gapExtend = 2;
- break;
- case 8:
- $gapOpen = 14;
- $gapExtend = 2;
- break;
- case 9:
- $gapOpen = 13;
- $gapExtend = 2;
- break;
- case 10:
- $gapOpen = 21;
- $gapExtend = 1;
- break;
- case 11:
- $gapOpen = 20;
- $gapExtend = 1;
- break;
- case 12:
- $gapOpen = 19;
- $gapExtend = 1;
- break;
- case 13:
- $gapOpen = 18;
- $gapExtend = 1;
- break;
- case 14:
- $gapOpen = 17;
- $gapExtend = 1;
- break;
- }
- break;
- case 3:
- $matrix ="BLOSUM80";
- $gapKey = $form_state['values']['gapCost'];
- switch ($gapKey) {
- case 0:
- $gapOpen = 8;
- $gapExtend = 2;
- break;
- case 1:
- $gapOpen = 7;
- $gapExtend = 2;
- break;
- case 2:
- $gapOpen = 6;
- $gapExtend = 2;
- break;
- case 3:
- $gapOpen = 11;
- $gapExtend = 1;
- break;
- case 4:
- $gapOpen = 10;
- $gapExtend = 1;
- break;
- case 5:
- $gapOpen = 9;
- $gapExtend = 1;
- break;
- }
- break;
- case 4:
- $matrix ="BLOSUM62";
- $gapKey = $form_state['values']['gapCost'];
- switch ($gapKey) {
- case 0:
- $gapOpen = 11;
- $gapExtend = 2;
- break;
- case 1:
- $gapOpen = 10;
- $gapExtend = 2;
- break;
- case 2:
- $gapOpen = 9;
- $gapExtend = 2;
- break;
- case 3:
- $gapOpen = 8;
- $gapExtend = 2;
- break;
- case 4:
- $gapOpen = 7;
- $gapExtend = 2;
- break;
- case 5:
- $gapOpen = 6;
- $gapExtend = 2;
- break;
- case 6:
- $gapOpen = 13;
- $gapExtend = 1;
- break;
- case 7:
- $gapOpen = 12;
- $gapExtend = 1;
- break;
- case 8:
- $gapOpen = 11;
- $gapExtend = 1;
- break;
- case 9:
- $gapOpen = 10;
- $gapExtend = 1;
- break;
- case 10:
- $gapOpen = 9;
- $gapExtend = 1;
- break;
- }
- break;
- case 5:
- $matrix ="BLOSUM45";
- $gapKey = $form_state['values']['gapCost'];
- switch ($gapKey) {
- case 0:
- $gapOpen = 13;
- $gapExtend = 3;
- break;
- case 1:
- $gapOpen = 12;
- $gapExtend = 3;
- break;
- case 2:
- $gapOpen = 11;
- $gapExtend = 3;
- break;
- case 3:
- $gapOpen = 10;
- $gapExtend = 3;
- break;
- case 4:
- $gapOpen = 15;
- $gapExtend = 2;
- break;
- case 5:
- $gapOpen = 14;
- $gapExtend = 2;
- break;
- case 6:
- $gapOpen = 13;
- $gapExtend = 2;
- break;
- case 7:
- $gapOpen = 12;
- $gapExtend = 2;
- break;
- case 8:
- $gapOpen = 19;
- $gapExtend = 1;
- break;
- case 9:
- $gapOpen = 18;
- $gapExtend = 1;
- break;
- case 10:
- $gapOpen = 17;
- $gapExtend = 1;
- break;
- case 11:
- $gapOpen = 16;
- $gapExtend = 1;
- break;
- }
- break;
- case 6:
- $matrix ="BLOSUM50";
- $gapKey = $form_state['values']['gapCost'];
- switch ($gapKey) {
- case 0:
- $gapOpen = 13;
- $gapExtend = 3;
- break;
- case 1:
- $gapOpen = 12;
- $gapExtend = 3;
- break;
- case 2:
- $gapOpen = 11;
- $gapExtend = 3;
- break;
- case 3:
- $gapOpen = 10;
- $gapExtend = 3;
- break;
- case 4:
- $gapOpen = 9;
- $gapExtend = 3;
- break;
- case 5:
- $gapOpen = 16;
- $gapExtend = 2;
- break;
- case 6:
- $gapOpen = 15;
- $gapExtend = 2;
- break;
- case 7:
- $gapOpen = 14;
- $gapExtend = 2;
- break;
- case 8:
- $gapOpen = 13;
- $gapExtend = 2;
- break;
- case 9:
- $gapOpen = 12;
- $gapExtend = 2;
- break;
- case 10:
- $gapOpen = 19;
- $gapExtend = 1;
- break;
- case 11:
- $gapOpen = 18;
- $gapExtend = 1;
- break;
- case 12:
- $gapOpen = 17;
- $gapExtend = 1;
- break;
- case 13:
- $gapOpen = 16;
- $gapExtend = 1;
- break;
- case 14:
- $gapOpen = 15;
- $gapExtend = 1;
- break;
- }
- break;
- case 7:
- $matrix ="BLOSUM90";
- $gapKey = $form_state['values']['gapCost'];
- switch ($gapKey) {
- case 0:
- $gapOpen = 9;
- $gapExtend = 2;
- break;
- case 1:
- $gapOpen = 8;
- $gapExtend = 2;
- break;
- case 2:
- $gapOpen = 7;
- $gapExtend = 2;
- break;
- case 3:
- $gapOpen = 6;
- $gapExtend = 2;
- break;
- case 4:
- $gapOpen = 11;
- $gapExtend = 1;
- break;
- case 5:
- $gapOpen = 10;
- $gapExtend = 1;
- break;
- case 6:
- $gapOpen = 9;
- $gapExtend = 1;
- break;
- }
- break;
- }
- // If the query was submitted via the texrfield then create a file containing it
- if ( isset($form_state['qFlag']) ) {
- if ( $form_state['qFlag'] == 'seqQuery' ) {
- $seq_content = $form_state['values']['FASTA'];
- $query = '/tmp/' . date('YMd_His') . '_query.fasta';
- file_put_contents ( $query , $seq_content);
- }
- elseif ( $form_state['qFlag'] == 'upQuery' ) {
- $query = $form_state['upQuery_path'];
- }
- }
- // If the BLAST database was uploaded then use it to run the BLAST
- if ($form_state['dbFlag'] == 'upQuery') {
- // Since we only support using the -db flag (not -subject) we need to create a
- // blast database for the FASTA uploaded.
- // NOTE: We can't support subject because we need to generate the ASN.1+ format
- // to provide multiple download type options from the same BLAST
- $blastdb_with_path = $form_state['upDB_path'];
- system("makeblastdb -in $blastdb_with_path -dbtype prot -parse_seqids");
- }
- // Otherwise, we are using one of the website provided BLAST databases so form the
- // BLAST command accordingly
- elseif ($form_state['dbFlag'] == 'blastdb') {
- $selected_db = $form_state['values']['SELECT_DB'];
- $blastdb_node = node_load($selected_db);
- $blastdb_with_path = $blastdb_node->db_path;
- }
- // Actually submit the BLAST Tripal Job
- // NOTE: Tripal jobs needs to be executed from the command-line before it will be run!!
- $blastdb_with_suffix = $blastdb_with_path . '.psq';
- if (is_readable($blastdb_with_suffix)) {
- global $user;
- $output_filestub = date('YMd_His');
- $job_args = array(
- 'program' => 'blastp',
- 'query' => $query,
- 'database' => $blastdb_with_path,
- 'output_filename' => $output_filestub,
- 'options' => array(
- 'evalue' => $eVal,
- 'word_size' => $wordSize,
- 'gapopen' => $gapOpen,
- 'gapextend' => $gapExtend,
- 'matrix' => $matrix
- )
- );
- $job_id = tripal_add_job("BLAST (blastp): $query",'blast_job','run_BLAST_tripal_job', $job_args, $user->uid);
- // Redirect to the BLAST results page
- drupal_goto("blast/report/$job_id");
- }
- else {
- $dbfile_uploaded_msg = ($form_state['dbFlag'] == 'upQuery') ? 'The BLAST database was submitted via user upload.' : 'Existing BLAST Database was chosen';
- tripal_report_error(
- 'blast_ui',
- TRIPAL_ERROR,
- "BLAST database %db unaccessible. $dbfile_uploaded_msg",
- array('%db' => $blastdb_with_path)
- );
- drupal_set_message('BLAST database unaccessible. Please contact the site administrator.','error');
- }
- }
- /**
- * FASTA validating parser
- *
- * @param $sequence
- * A string of characters to be validated. A sequence in FASTA format begins with a single-line description, followed by lines of sequence data.
- * The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column.
- * The word following the ">" symbol is the identifier of the sequence, and the rest of the line is the description (both are optional).
- * There should be no space between the ">" and the first letter of the identifier. The sequence ends if another line starting with a ">" appears;
- * this indicates the start of another sequence.
- *
- * @return
- * Return a boolean. 1 if the sequence does not pass the format valifation stage and 0 otherwise.
- *
- */
- function validateFasta($sequence) {
- $fastaIdRegEx = '/^>.*(\\n|\\r)/';
- $fastaSeqRegEx = '/[^acgturykmswbdhvnxACGTURYKMSWBDHVNX\*\-\n\r]/';
- if ( preg_match($fastaSeqRegEx,$sequence) && !(preg_match($fastaIdRegEx,$sequence)) ) {
- $flag = 1;
- } else {
- $flag = 0;
- }
- return $flag;
- }
- /**
- * Fill the first dropdown list with appropriate options
- *
- * @return
- * An array consisting of matrices name for the first dropdown list
- */
- function _ajax_example_get_first_dropdown_options() {
- return drupal_map_assoc(array(
- t('PAM30'),
- t('PAM70'),
- t('PAM250'),
- t('BLOSUM80'),
- t('BLOSUM62'),
- t('BLOSUM45'),
- t('BLOSUM50'),
- t('BLOSUM90'),
- ));
- }
- /**
- * Fill the second dropdown list with appropriate options
- *
- * @return
- * An array containing open and extension gap values for the chosen matrix (to fill the second dropdown list)
- */
- function _ajax_example_get_second_dropdown_options($key = '') {
- $options = array(
- t('PAM30') => drupal_map_assoc(array(
- t('Existence: 7 Extension: 2'),
- t('Existence: 6 Extension: 2'),
- t('Existence: 5 Extension: 2'),
- t('Existence: 10 Extension: 1'),
- t('Existence: 9 Extension: 1'),
- t('Existence: 8 Extension: 1'),
- )),
- t('PAM70') => drupal_map_assoc(array(
- t('Existence: 8 Extension: 2'),
- t('Existence: 7 Extension: 2'),
- t('Existence: 6 Extension: 2'),
- t('Existence: 11 Extension: 1'),
- t('Existence: 10 Extension: 1'),
- t('Existence: 9 Extension: 1'),
- )),
- t('PAM250') => drupal_map_assoc(array(
- t('Existence: 15 Extension: 3'),
- t('Existence: 14 Extension: 3'),
- t('Existence: 13 Extension: 3'),
- t('Existence: 12 Extension: 3'),
- t('Existence: 11 Extension: 3'),
- t('Existence: 17 Extension: 2'),
- t('Existence: 16 Extension: 2'),
- t('Existence: 15 Extension: 2'),
- t('Existence: 14 Extension: 2'),
- t('Existence: 13 Extension: 2'),
- t('Existence: 21 Extension: 1'),
- t('Existence: 20 Extension: 1'),
- t('Existence: 19 Extension: 1'),
- t('Existence: 18 Extension: 1'),
- t('Existence: 17 Extension: 1'),
- )),
- t('BLOSUM80') => drupal_map_assoc(array(
- t('Existence: 8 Extension: 2'),
- t('Existence: 7 Extension: 2'),
- t('Existence: 6 Extension: 2'),
- t('Existence: 11 Extension: 1'),
- t('Existence: 10 Extension: 1'),
- t('Existence: 9 Extension: 1'),
- )),
- t('BLOSUM62') => drupal_map_assoc(array(
- t('Existence: 11 Extension: 2'),
- t('Existence: 10 Extension: 2'),
- t('Existence: 9 Extension: 2'),
- t('Existence: 8 Extension: 2'),
- t('Existence: 7 Extension: 2'),
- t('Existence: 6 Extension: 2'),
- t('Existence: 13 Extension: 1'),
- t('Existence: 12 Extension: 1'),
- t('Existence: 11 Extension: 1'),
- t('Existence: 10 Extension: 1'),
- t('Existence: 9 Extension: 1'),
- )),
- t('BLOSUM45') => drupal_map_assoc(array(
- t('Existence: 13 Extension: 3'),
- t('Existence: 12 Extension: 3'),
- t('Existence: 11 Extension: 3'),
- t('Existence: 10 Extension: 3'),
- t('Existence: 15 Extension: 2'),
- t('Existence: 14 Extension: 2'),
- t('Existence: 13 Extension: 2'),
- t('Existence: 12 Extension: 2'),
- t('Existence: 19 Extension: 1'),
- t('Existence: 18 Extension: 1'),
- t('Existence: 17 Extension: 1'),
- t('Existence: 16 Extension: 1'),
- )),
- t('BLOSUM50') => drupal_map_assoc(array(
- t('Existence: 13 Extension: 3'),
- t('Existence: 12 Extension: 3'),
- t('Existence: 11 Extension: 3'),
- t('Existence: 10 Extension: 3'),
- t('Existence: 9 Extension: 3'),
- t('Existence: 16 Extension: 2'),
- t('Existence: 15 Extension: 2'),
- t('Existence: 14 Extension: 2'),
- t('Existence: 13 Extension: 2'),
- t('Existence: 12 Extension: 2'),
- t('Existence: 19 Extension: 1'),
- t('Existence: 18 Extension: 1'),
- t('Existence: 17 Extension: 1'),
- t('Existence: 16 Extension: 1'),
- t('Existence: 15 Extension: 1'),
- )),
- t('BLOSUM90') => drupal_map_assoc(array(
- t('Existence: 9 Extension: 2'),
- t('Existence: 8 Extension: 2'),
- t('Existence: 7 Extension: 2'),
- t('Existence: 6 Extension: 2'),
- t('Existence: 11 Extension: 1'),
- t('Existence: 10 Extension: 1'),
- t('Existence: 9 Extension: 1'),
- )),
- );
- if (isset($options[$key])) {
- return $options[$key];
- } else {
- return array();
- }
- }
- /**
- * Respond to Ajax dropdown call
- */
- function ajax_example_dependent_dropdown_callback($form, $form_state) {
- return $form['ALG']['SParam']['gapCost'];
- }
- // call back function for example sequence
- function ajax_protein_text_area_callback($form, $form_state) {
- $element = $form['query']['FASTA']; // Get example Protein sequence
- $element['#value'] =
- '>gi|166477|gb|AAA96434.1| resveratrol synthase [Arachis hypogaea]
- MVSVSGIRKVQRAEGPATVLAIGTANPPNCIDQSTYADYYFRVTNSEHMTDLKKKFQRICERTQIKNRHM
- YLTEEILKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGV
- DYELIVLLGLDPCVKRYMMYHQGCFAGGTVLRLAKDLAENNKDARVLIVCSENTAVTFRGPSETDMDSLV
- GQALFADGAAAIIIGSDPVPEVEKPIFELVSTDQKLVPGSHGAIGGLLREVGLTFYLNKSVPDIISQNIN
- DALNKAFDPLGISDYNSIFWIAHPGGRAILDQVEQKVNLKPEKMKATRDVLSNYGNMSSACVFFIMDLMR
- KRSLEEGLKTTGEGLDWGVLFGFGPGLTIETVVLRSVAI';
- return $element;
- }
|